KEGG   Pan paniscus (bonobo): 100981974Help
Entry
100981974         CDS       T02283                                 

Gene name
GK2
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100981974 (GK2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100981974 (GK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100981974 (GK2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100981974 (GK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 553 aa AA seqDB search
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTRQSPESGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccgaagacagcagctgtggggccgttggtgggagcggtggtccagggcacc
aactccactcgctttctggttttcaattcaaaaacagcggaactacttagtcatcacaaa
gtggaattaacacaagagttcccaaaagaaggatgggtggaacaagaccctaaggaaatt
cttcagtctgtctacgagtgtatagcgagaacgtgtgagaaacttgatgaactgaatatt
gatatatccaacataaaagctgttggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaacaggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
actactgttgaggatcttagtaaaaaaattccaggaaatagtaacttcgtcaagtctaag
acaggccttccactcagcacttacttcagtgcagtaaaacttcgttggatgcttgacaat
gtgagaaacgtccaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttgacaggaggagttaatggaggtgtgcattgtacagatgtaaca
aatgcaagtaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatggaccttcttccaaatgtcttcagttcttctgagatctat
ggcctaattaaaactggagccctggaaggtgtgccaatatctgggtgtttgggggaccaa
tgtgctgcattagtaggacaaatgtgcttccaggagggacaagccaaaaacacctatgga
acaggttgcttcttactgtgtaatacaggtcgtaaatgtgtgttttctgaacatggcctt
ctgaccacagtagcttacaaactaggcagagagaagccagcatactatgcactggaaggt
tctgttgctatagcaggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaggagacattgaaagacttgctaaagaagtaggaacttcttatggctgttacttt
gtcccagccttttcagggttatatgcaccttattgggagcccagtgcaagagggatactc
tgtggcctcactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaacccgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catttgcaggtagatggaggaatgaccaacaacaaagttcttatgcaactacaagcagat
attcttcatattccagtaataaaaccctttatgcctgaaacaactgcactaggagctgcc
atggcagcaggggctgcagagggagtaagcgtttggagccttgaaccccaggctttgtcg
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgttat
gccacatggaagaaagccgtaatgaagtcaatgggttgggttacccgtcagtctcctgaa
agtggtgatccttctatcttctctagtctgcctttgggattttttatagtgagtagcatg
gtaatgctaattggagcaagatatatatcgggtgtaccataa

DBGET integrated database retrieval system