KEGG   Pan paniscus (bonobo): 100982030Help
Entry
100982030         CDS       T02283                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100982030 (USP1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100982030 (USP1)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100982030 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 785 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPK
EEMSGINSMEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQSLEENQRQT
RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHESDRNKESSD
QTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatggactttcaagaggtagcccttcaaagaaa
aacagactttccttaaagttttttcagaaaaaggaaactaagagagctttggatttcaca
gattctcaagaaaatgaagaaaaagcttctgaatatagagcatctgaaattgatcaagtt
gttcctgcagcacagtcttcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgctatcttaatagtatacttcaggtattatat
ttttgtcccggttttaaatctggagtaaagcacttatttaatattatttcaaggaagaaa
gaagctctaaaggatgaagccaatcaaaaagacaaaggaaattgcaaagaagattctttg
gcaagttatgaattgatatgcagtttacagtccttaatcatttcggttgaacagctccag
gctagttttctcttaaatccagagaaatatactgatgaacttgccactcagccaaggcga
ctgcttaacacactgagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacaatgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggcagaattacctactaaggtagaagaaatacctcatccgaaa
gaggaaatgagtggtattaacagcatggagatggacagtatgaggcattctgaagacttt
aaagaaaaactcccaaaaggaaatgggaaaagaaaaagtgacactgaatttggtaacatg
aagaaaaaagttaaagtatccaaggaacaccagtcattggaagagaaccagagacaaact
agatcaaaaagaaaagctacaagtgatacattagagagtcctcctaaaataattcccaag
tatatttctgaaaatgagagtccaagaccctcacaaaagaaatcaagagttaaaataaat
tggttaaagtctgcaactaagcaacccagcattctttctaaattctgtagtctgggaaaa
ataacaacaaaccaaggagtcaaaggacaatctaaagaaaatgaatgtgatcctgaagag
gacttggggaagtgtgaaagtgataacacaactaatggttgtggacttgaatctccagga
aatactgttacacctgtaaatgttaatgaagttaaacccataaacaaaggtgaagaacaa
attggttttgagctagtggagaaattatttcaaggtcagctggtattaaggacgcgttgc
ttggaatgtgaaagtttaacagaaagaagagaagattttcaagacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacaatttgcttcagtagaaaggattgtagga
gaagataaatatttctgtgaaaactgccatcattatactgaagctgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggtttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttattgacacctctt
aaattgtcactagaagaatggagcacaaagccaactaacgacagctatggattatttgcg
gttgtgatgcatagtggtattacaattagtagtgggcattacactgcttctgttaaagtc
actgaccttaacagtttagaactagataaaggaaattttgtggttgaccaaatgtgtgaa
ataggtaagccagaaccattgaatgaggaggaagcaaggggtgtggttgagaattataat
gatgaagaagtgtcaattagagttggtggaaatacacagccaagtaaagttttgaacaaa
aaaaatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagcta
tacaacaaagcctctaatcctgataaggttgctagtacagcgtttgctgaaaatagaaat
tctgagactagtgatactactgggacccatgaatctgatagaaacaaggaatccagtgac
caaacaggcattaatattagtggatttgagaacaaaatttcatacgtagtgcaaagctta
aaggagtatgaggggaagtggttgctttttgatgattctgaagtcaaagttactgaagag
aaggactttctgaattctctttccccttctacatctcctacttctactccttacttgcta
ttttataagaaattatag

DBGET integrated database retrieval system