KEGG   Pan paniscus (bonobo): 100982095Help
Entry
100982095         CDS       T02283                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  
TNF receptor-associated factor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Sphingolipid signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100982095 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100982095 (TRAF2)
   04064 NF-kappa B signaling pathway
    100982095 (TRAF2)
   04668 TNF signaling pathway
    100982095 (TRAF2)
   04071 Sphingolipid signaling pathway
    100982095 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100982095 (TRAF2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100982095 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100982095 (TRAF2)
  Development
   04380 Osteoclast differentiation
    100982095 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100982095 (TRAF2)
   05203 Viral carcinogenesis
    100982095 (TRAF2)
   05222 Small cell lung cancer
    100982095 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100982095 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    100982095 (TRAF2)
   05168 Herpes simplex infection
    100982095 (TRAF2)
   05169 Epstein-Barr virus infection
    100982095 (TRAF2)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100982095 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 534 aa AA seqDB search
MGLEGLQGSLKLCDSASLSLDRRALLFTGVTALMAAASVTPPGSLELLQPGFSKTLLGTK
LEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILES
SSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGE
KERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVK
TCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWLREHLAMLLSSVLEAKPLSGDQSHAGSE
LLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERS
IGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYG
YKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAF
RPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggactagagggtctccaaggctccctgaagctctgcgattctgcttctctgagtctt
gaccgcagggctttgttgttcacgggggtcacagctctcatggctgcagctagcgtgacc
ccccctggctccctggagttgctacagcccggcttctccaagaccctcctggggaccaag
ctggaagccaagtacctgtgctccgcctgcagaaacgtcctccgcaggcccttccaggcg
cagtgtggccaccggtactgctccttctgcctggccagcatcctcagctctgggcctcag
aactgtgctgcctgtgttcacgagggcatatatgaagaaggcatttctattttagaaagc
agttcggccttcccagataatgctgcccgcagggaggtggagagcctgccggccgtctgt
cccagtgatggatgcacctggaaggggaccctgaaagaatacgagagctgccacgagggc
cgctgcccgctcatgctgaccgaatgtcccgcgtgcaaaggcctggtccgccttggtgaa
aaggagcgccacctggagcacgagtgcccggagagaagcctgagctgccggcattgccgg
gcgccctgctgcggagcagacgtgaaggcgcaccacgaggtctgccccaagttcccctta
acttgtgacggctgcggcaagaagaagatcccccgggagaagtttcaggaccacgtcaag
acttgtggcaagtgtcgagtcccttgcagattccacgccatcggctgcctcgagacggta
gagggtgagaaacagcaggagcacgaggcgcagtggctgcgggagcacctggccatgcta
ctgagctcggtgctggaggcaaagcccctctcgggagaccagagccacgcggggtcagag
ctcctgcagaggtgcgagagcctggagaagaagacggccacttttgagaacattgtctgc
gtcctgaaccgggaggtggagagggtggccatgactgccgaggcctgcagccggcagcac
cggctggaccaagacaagattgaagccctgagtagcaaggtgcagcagctggagaggagc
attggcctcaaggacctggcgatggctgacttggagcagaaggtcttggagatggaggca
tccacctacgatggggtcttcatctggaagatctcagacttcgccaggaagcgccaggaa
gctgtggctggccgcacacctgccatcttctccccagccttctacaccagcaggtacggc
tacaagatgtgtctgcgtatctacctgaacggcgacggcaccgggcgaggaacacacctg
tccctcttctttgtggtgatgaagggcccgaatgacgccctgctgcggtggcccttcaac
cagaaggtgaccttaatgctgctcgaccagaataaccgggagcacgtgattgacgccttc
aggcccgacgtgacttcatcctcttttcagaggccagtcaacgacatgaacatcgcaagc
ggctgccccctcttctgccccgtctccaagatggaggcaaagaattcctacgtgcgggac
gatgccatcttcatcaaggccattgtggacctgacagggctctaa

DBGET integrated database retrieval system