KEGG   Pan paniscus (bonobo): 100982237Help
Entry
100982237         CDS       T02283                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:pps04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:pps04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:pps04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:pps04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 622 aa AA seqDB search
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPVTFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENSKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaaccgttttcactctgctactttttctcaacacctgc
cttctgaatggacaattacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttatgtggac
gtgacttacatagttcaaccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagcgcgtggagtcca
gtgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccctaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccactctgttgaatgaagcaggtaaagatgctttaaaa
tcctctcaaaccattaagtctagagaagagggaaaggcaacccagcagagggaggtagaa
agcttccattccgagactgaccaggatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggtgca
ttatcattgctaccaaaacagagagagaacagcggcaagcccaagaagcccgggactcct
gagaacagtaaggagtatgccaaggtgtccggggtcatggataacaacatcctggtgttg
gtgccagatccacatgctaaaaatgtggcttgctttgaagaatcagccaaagaggcccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttcactgcaacatcaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcactga

DBGET integrated database retrieval system