KEGG   Pan paniscus (bonobo): 100982237Help
Entry
100982237         CDS       T02283                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04080  Neuroactive ligand-receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04630  Jak-STAT signaling pathway
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100982237 (PRLR)
   04151 PI3K-Akt signaling pathway
    100982237 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100982237 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100982237 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    100982237 (PRLR)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  Prolactin receptor family
   100982237 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 100982237
NCBI-ProteinID: XP_003806712
Position
5
AA seq 622 aa AA seqDB search
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPVTFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENSKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaaccgttttcactctgctactttttctcaacacctgc
cttctgaatggacaattacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttatgtggac
gtgacttacatagttcaaccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagcgcgtggagtcca
gtgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccctaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccactctgttgaatgaagcaggtaaagatgctttaaaa
tcctctcaaaccattaagtctagagaagagggaaaggcaacccagcagagggaggtagaa
agcttccattccgagactgaccaggatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggtgca
ttatcattgctaccaaaacagagagagaacagcggcaagcccaagaagcccgggactcct
gagaacagtaaggagtatgccaaggtgtccggggtcatggataacaacatcctggtgttg
gtgccagatccacatgctaaaaatgtggcttgctttgaagaatcagccaaagaggcccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttcactgcaacatcaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcactga

DBGET integrated database retrieval system