KEGG   Pan paniscus (bonobo): 100982469Help
Entry
100982469         CDS       T02283                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2 (Drosophila)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100982469 (SUV39H2)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100982469 (SUV39H2)
Chromosome [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100982469 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100982469 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 410 aa AA seqDB search
MAAVGAEPRGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcggggccgagccgcgaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactccaaaagacaataacaaaactttgaaa
cctgccattgctgagtacattgtgaagaaggctaaacaaaggatagctctgcagagatgg
caagatgaactcaacagaagaaagaatcataaaggaatgatatttgttgaaaatactgtt
gatttagagggcccaccttcagacttctattacattaacgaatacaaaccagctcctgga
atcagcttagtcaatgaagctacctttggttgttcatgcacagattgcttctttcaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaaccaacaaattaaaatc
ccacctggtactcccatctatgaatgcaactcaaggtgtcaatgtggtcctgattgtccc
aataggattgtacaaaaaggcacacagtattcgctttgcatctttcgaactagcaatgga
cgtggctggggtgtaaagacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtaatcacgagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcatcgataacctcgatactcgtcttccccgaatagcattgttttctacaaga
accataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system