KEGG   Pan paniscus (bonobo): 100982469Help
Entry
100982469         CDS       T02283                                 

Gene name
SUV39H2
Definition
suppressor of variegation 3-9 homolog 2 (Drosophila)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100982469 (SUV39H2)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100982469 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MAAVGAEPRGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcggggccgagccgcgaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactccaaaagacaataacaaaactttgaaa
cctgccattgctgagtacattgtgaagaaggctaaacaaaggatagctctgcagagatgg
caagatgaactcaacagaagaaagaatcataaaggaatgatatttgttgaaaatactgtt
gatttagagggcccaccttcagacttctattacattaacgaatacaaaccagctcctgga
atcagcttagtcaatgaagctacctttggttgttcatgcacagattgcttctttcaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaaccaacaaattaaaatc
ccacctggtactcccatctatgaatgcaactcaaggtgtcaatgtggtcctgattgtccc
aataggattgtacaaaaaggcacacagtattcgctttgcatctttcgaactagcaatgga
cgtggctggggtgtaaagacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtaatcacgagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcatcgataacctcgatactcgtcttccccgaatagcattgttttctacaaga
accataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system