KEGG   Pan paniscus (bonobo): 100982469Help
Entry
100982469         CDS       T02283                                 

Gene name
SUV39H2
Definition
suppressor of variegation 3-9 homolog 2 (Drosophila)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pps00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MAAVGAEPRGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcggggccgagccgcgaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactccaaaagacaataacaaaactttgaaa
cctgccattgctgagtacattgtgaagaaggctaaacaaaggatagctctgcagagatgg
caagatgaactcaacagaagaaagaatcataaaggaatgatatttgttgaaaatactgtt
gatttagagggcccaccttcagacttctattacattaacgaatacaaaccagctcctgga
atcagcttagtcaatgaagctacctttggttgttcatgcacagattgcttctttcaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaaccaacaaattaaaatc
ccacctggtactcccatctatgaatgcaactcaaggtgtcaatgtggtcctgattgtccc
aataggattgtacaaaaaggcacacagtattcgctttgcatctttcgaactagcaatgga
cgtggctggggtgtaaagacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtaatcacgagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcatcgataacctcgatactcgtcttccccgaatagcattgttttctacaaga
accataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system