KEGG   Pan paniscus (bonobo): 100982480Help
Entry
100982480         CDS       T02283                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04530  Tight junction
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05132  Salmonella infection
pps05133  Pertussis
pps05142  Chagas disease (American trypanosomiasis)
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05164  Influenza A
pps05167  Kaposi's sarcoma-associated herpesvirus infection
pps05168  Herpes simplex infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Module
pps_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100982480 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100982480 (MAPK8)
   04010 MAPK signaling pathway
    100982480 (MAPK8)
   04012 ErbB signaling pathway
    100982480 (MAPK8)
   04310 Wnt signaling pathway
    100982480 (MAPK8)
   04668 TNF signaling pathway
    100982480 (MAPK8)
   04068 FoxO signaling pathway
    100982480 (MAPK8)
   04071 Sphingolipid signaling pathway
    100982480 (MAPK8)
   04024 cAMP signaling pathway
    100982480 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100982480 (MAPK8)
   04137 Mitophagy - animal
    100982480 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    100982480 (MAPK8)
   04215 Apoptosis - multiple species
    100982480 (MAPK8)
   04217 Necroptosis
    100982480 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100982480 (MAPK8)
   04530 Tight junction
    100982480 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100982480 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100982480 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100982480 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100982480 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100982480 (MAPK8)
   04659 Th17 cell differentiation
    100982480 (MAPK8)
   04657 IL-17 signaling pathway
    100982480 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100982480 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    100982480 (MAPK8)
   04920 Adipocytokine signaling pathway
    100982480 (MAPK8)
   04912 GnRH signaling pathway
    100982480 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100982480 (MAPK8)
   04917 Prolactin signaling pathway
    100982480 (MAPK8)
   04926 Relaxin signaling pathway
    100982480 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    100982480 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100982480 (MAPK8)
   04722 Neurotrophin signaling pathway
    100982480 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100982480 (MAPK8)
  Development
   04380 Osteoclast differentiation
    100982480 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100982480 (MAPK8)
   05231 Choline metabolism in cancer
    100982480 (MAPK8)
   05210 Colorectal cancer
    100982480 (MAPK8)
   05212 Pancreatic cancer
    100982480 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100982480 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100982480 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100982480 (MAPK8)
   04931 Insulin resistance
    100982480 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100982480 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    100982480 (MAPK8)
   05133 Pertussis
    100982480 (MAPK8)
   05152 Tuberculosis
    100982480 (MAPK8)
   05164 Influenza A
    100982480 (MAPK8)
   05161 Hepatitis B
    100982480 (MAPK8)
   05160 Hepatitis C
    100982480 (MAPK8)
   05168 Herpes simplex infection
    100982480 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100982480 (MAPK8)
   05169 Epstein-Barr virus infection
    100982480 (MAPK8)
   05145 Toxoplasmosis
    100982480 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    100982480 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    100982480 (MAPK8)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100982480 (MAPK8)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100982480 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 100982480
NCBI-ProteinID: XP_003809090
Position
Un
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system