KEGG   Pan paniscus (bonobo): 100982509Help
Entry
100982509         CDS       T02283                                 

Gene name
GNB2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04062  Chemokine signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04926  Relaxin signaling pathway
pps05032  Morphine addiction
pps05034  Alcoholism
pps05167  Kaposi's sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100982509 (GNB2)
   04371 Apelin signaling pathway
    100982509 (GNB2)
   04151 PI3K-Akt signaling pathway
    100982509 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100982509 (GNB2)
  Endocrine system
   04926 Relaxin signaling pathway
    100982509 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100982509 (GNB2)
   04727 GABAergic synapse
    100982509 (GNB2)
   04725 Cholinergic synapse
    100982509 (GNB2)
   04728 Dopaminergic synapse
    100982509 (GNB2)
   04726 Serotonergic synapse
    100982509 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100982509 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100982509 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100982509 (GNB2)
  Substance dependence
   05032 Morphine addiction
    100982509 (GNB2)
   05034 Alcoholism
    100982509 (GNB2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100982509 (GNB2)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100982509 (GNB2)
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100982509 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 100982509
NCBI-ProteinID: XP_003812955
Position
7
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacattgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacccggaggaccctccgtgggcacctggcaaagatctatgcc
atgcactgggggaccgactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atctgggacagctacaccaccaacaaggtccacgccatcccgctgcgctcctcctgggta
atgacctgtgcctacgcgccctcagggaactttgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgttgccgcttcctggatgacaaccaaatcatcaccagc
tctggggataccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagtggggatgtgatgtccctgtccctggcccccgatggccgcacgtttgtg
tcaggcgcctgtgatgcctctatcaagctgtgggacgtgcgggattccatgtgccgacag
accttcatcggccatgaatccgacatcaatgcagtggctttcttccccaacggctacgcc
ttcaccaccggctctgacgacgccacatgccgcctcttcgacctgcgggccgatcaggag
ctcctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcacgc
agcggccggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggagtcctcgctggccacgacaaccgcgtgagctgcctcggggtc
accgacgatggcatggctgtggccacgggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system