KEGG   Pan paniscus (bonobo): 100982509Help
Entry
100982509         CDS       T02283                                 

Gene name
GNB2
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
pps  Pan paniscus (bonobo)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100982509 (GNB2)
   04151 PI3K-Akt signaling pathway
    100982509 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100982509 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100982509 (GNB2)
   04727 GABAergic synapse
    100982509 (GNB2)
   04725 Cholinergic synapse
    100982509 (GNB2)
   04728 Dopaminergic synapse
    100982509 (GNB2)
   04726 Serotonergic synapse
    100982509 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100982509 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100982509 (GNB2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    100982509 (GNB2)
   05034 Alcoholism
    100982509 (GNB2)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100982509 (GNB2)
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100982509 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacattgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacccggaggaccctccgtgggcacctggcaaagatctatgcc
atgcactgggggaccgactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atctgggacagctacaccaccaacaaggtccacgccatcccgctgcgctcctcctgggta
atgacctgtgcctacgcgccctcagggaactttgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgttgccgcttcctggatgacaaccaaatcatcaccagc
tctggggataccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagtggggatgtgatgtccctgtccctggcccccgatggccgcacgtttgtg
tcaggcgcctgtgatgcctctatcaagctgtgggacgtgcgggattccatgtgccgacag
accttcatcggccatgaatccgacatcaatgcagtggctttcttccccaacggctacgcc
ttcaccaccggctctgacgacgccacatgccgcctcttcgacctgcgggccgatcaggag
ctcctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcacgc
agcggccggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggagtcctcgctggccacgacaaccgcgtgagctgcctcggggtc
accgacgatggcatggctgtggccacgggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system