KEGG   Pan paniscus (bonobo): 100982589Help
Entry
100982589         CDS       T02283                                 

Gene name
PRKACG
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04340  Hedgehog signaling pathway
pps04371  Apelin signaling pathway
pps04530  Tight junction
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04740  Olfactory transduction
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04910  Insulin signaling pathway
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing's syndrome
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04962  Vasopressin-regulated water reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04976  Bile secretion
pps05012  Parkinson's disease
pps05020  Prion diseases
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05146  Amoebiasis
pps05165  Human papillomavirus infection
pps05166  HTLV-I infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05414  Dilated cardiomyopathy (DCM)
Module
pps_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100982589 (PRKACG)
   04010 MAPK signaling pathway
    100982589 (PRKACG)
   04310 Wnt signaling pathway
    100982589 (PRKACG)
   04340 Hedgehog signaling pathway
    100982589 (PRKACG)
   04371 Apelin signaling pathway
    100982589 (PRKACG)
   04020 Calcium signaling pathway
    100982589 (PRKACG)
   04024 cAMP signaling pathway
    100982589 (PRKACG)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100982589 (PRKACG)
  Cell growth and death
   04114 Oocyte meiosis
    100982589 (PRKACG)
  Cellular community - eukaryotes
   04530 Tight junction
    100982589 (PRKACG)
   04540 Gap junction
    100982589 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100982589 (PRKACG)
   04062 Chemokine signaling pathway
    100982589 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    100982589 (PRKACG)
   04910 Insulin signaling pathway
    100982589 (PRKACG)
   04922 Glucagon signaling pathway
    100982589 (PRKACG)
   04923 Regulation of lipolysis in adipocyte
    100982589 (PRKACG)
   04912 GnRH signaling pathway
    100982589 (PRKACG)
   04913 Ovarian Steroidogenesis
    100982589 (PRKACG)
   04915 Estrogen signaling pathway
    100982589 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    100982589 (PRKACG)
   04921 Oxytocin signaling pathway
    100982589 (PRKACG)
   04926 Relaxin signaling pathway
    100982589 (PRKACG)
   04918 Thyroid hormone synthesis
    100982589 (PRKACG)
   04919 Thyroid hormone signaling pathway
    100982589 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    100982589 (PRKACG)
   04916 Melanogenesis
    100982589 (PRKACG)
   04924 Renin secretion
    100982589 (PRKACG)
   04925 Aldosterone synthesis and secretion
    100982589 (PRKACG)
   04927 Cortisol synthesis and secretion
    100982589 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100982589 (PRKACG)
   04270 Vascular smooth muscle contraction
    100982589 (PRKACG)
  Digestive system
   04970 Salivary secretion
    100982589 (PRKACG)
   04971 Gastric acid secretion
    100982589 (PRKACG)
   04976 Bile secretion
    100982589 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100982589 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100982589 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    100982589 (PRKACG)
   04727 GABAergic synapse
    100982589 (PRKACG)
   04725 Cholinergic synapse
    100982589 (PRKACG)
   04728 Dopaminergic synapse
    100982589 (PRKACG)
   04726 Serotonergic synapse
    100982589 (PRKACG)
   04720 Long-term potentiation
    100982589 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    100982589 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    100982589 (PRKACG)
   04742 Taste transduction
    100982589 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    100982589 (PRKACG)
  Aging
   04211 Longevity regulating pathway - mammal
    100982589 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    100982589 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    100982589 (PRKACG)
   04714 Thermogenesis
    100982589 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100982589 (PRKACG)
   05205 Proteoglycans in cancer
    100982589 (PRKACG)
   05203 Viral carcinogenesis
    100982589 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100982589 (PRKACG)
   05020 Prion diseases
    100982589 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    100982589 (PRKACG)
   05031 Amphetamine addiction
    100982589 (PRKACG)
   05032 Morphine addiction
    100982589 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100982589 (PRKACG)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100982589 (PRKACG)
  Infectious diseases
   05166 HTLV-I infection
    100982589 (PRKACG)
   05169 Epstein-Barr virus infection
    100982589 (PRKACG)
   05165 Human papillomavirus infection
    100982589 (PRKACG)
   05146 Amoebiasis
    100982589 (PRKACG)
  Drug resistance
   01522 Endocrine resistance
    100982589 (PRKACG)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100982589 (PRKACG)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKA family
   100982589 (PRKACG)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100982589 (PRKACG)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100982589 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 100982589
NCBI-ProteinID: XP_003824803
Position
9
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESANEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHRETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFSPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgcgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccgggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcatatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaaactccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcg
ctcgacctcatccaccgcgacctgaagccagagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttctcacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaaggatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaggagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system