KEGG   Pan paniscus (bonobo): 100983014Help
Entry
100983014         CDS       T02283                                 

Gene name
OTUD5
Definition
OTU domain containing 5
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:pps04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 376 aa AA seqDB search
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDY
LMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFH
GIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEES
WIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQPRKASATCS
SATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSPCAPGT
SSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLD
SMKKNKVHRDPPPDKS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgccactgtcgagcagcaggagcattggtttgaaaaggccctacgagacaag
aagggcttcatcatcaagcagatgaaggaggatggcgcctgtctcttccgggctgtagct
gaccaggtgtatggagaccaggacatgcatgaggttgtgcgaaagcattgcatggactat
ctgatgaagaatgccgactacttctccaactatgtcacagaggactttaccacctacatt
aacaggaagcggaaaaacaattgccatggcaaccacattgagatgcaggccatggcagag
atgtacaaccgtcctgtggaggtgtaccagtatagcacagaacccatcaacacattccat
gggatacatcaaaacgaggacgaacccattcgtgttagctaccatcggaatatccactat
aattcagtggtgaatcctaacaaggccaccattggtgtggggctgggcctgccatcattc
aaaccagggtttgcagagcagtctctgatgaagaatgccataaaaacatcggaggagtca
tggattgaacagcagatgctagaagacaagaaacgggccacggactgggaggccacaaat
gaggccatcgaggagcaggtggctcgggaatcctacctgcagtggttgcgggatcaggag
aaacaagctcgccaggtccgaggccccagccagccccggaaagccagcgccacatgcagt
tcggccacagcagcagcctccagtggcctggaggagtggactagccggtccccgcggcag
cggagttcagcctcgtcacctgagcaccctgagctgcatgctgaattgggcatgaagccc
ccttccccaggcactgttttagctcttgccaaacctccttcgccctgtgcgccaggtaca
agcagtcagttctcggcaggggccgaccgggcaacttccccccttgtgtccctctaccct
gctttggagtgccgggccctcattcagcagatgtccccctctgcctttggtctgaatgac
tgggatgatgatgagatcctagcgtcggtgctggcagtgtcccaacaggaatacctagac
agtatgaagaaaaacaaagtgcacagagacccgcccccagacaagagttga

DBGET integrated database retrieval system