KEGG   Pan paniscus (bonobo): 100983287Help
Entry
100983287         CDS       T02283                                 

Gene name
MAP3K12
Definition
mitogen-activated protein kinase kinase kinase 12
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100983287 (MAP3K12)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100983287 (MAP3K12)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   100983287 (MAP3K12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 893 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGG
GGPSPSPGGEPPPEPFANSVLQLHEQDAGGPGGAAGSPESRASRVRADEVRLQCQSGSGF
LEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE
EVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRP
VTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTK
MSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSL
HLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWR
EEVKLHFEKIKSEGTCLHRLEEELVMRRREELRHALDIREHYERKLERANNLYMELNALM
LQLELKERELLRREQALERRCPGLLKPHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRPD
ILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRTAVP
PHEPGGPGSPGGLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGSRGRGATG
GAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLVTGREGTSG
RGGSRAGSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQS
LSTFSSENPSDGEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPPSEV
IPGPEPSSLPIPHQELLRGERGPPNSEDSDCDSTELDNSNSVDALRPPASLPP
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcctccatgagacccgaacaccctctccttcctttgggggctttgtgtctacc
ctaagtgaggcatccatgcgcaagctggacccagacacttctgactgcactcccgagaag
gacctgacgcctacccagtgtgtacttcgagatgtggtaccccttggtgggcagggtggg
ggagggcccagcccctccccaggtggagagccgccccctgagccttttgccaacagtgtc
ctgcagctacatgagcaggatgcagggggcccagggggagcagctgggtcacctgagagt
cgggcatccagagttcgagctgacgaggtgcgactgcagtgccagagtggcagtggcttc
cttgagggcctctttggctgcctgcgccctgtctggaccatgattggcaaagcctactcc
actgagcacaagcagcagcaggaagacctttgggaggtcccctttgaggaaatcctggac
ctgcagtgggtgggctcaggggcccagggtgctgtcttcctggggcgcttccacggggag
gaggtggctgtgaagaaggtgcgagacctcaaagaaaccgacatcaagcacttgcgaaag
ctgaagcaccccaacatcatcactttcaagggtgtgtgcacccaggctccctgctactgc
atcctcatggagttctgcgcccagggccagctgtatgaggtactgcgggctggccgccct
gtcaccccctccttactggttgactggtccatgggcatcgctggtggcatgaactacctg
cacctgcacaagattatccacagggatctcaagtcacccaacatgctaatcacctacgac
gatgtggtgaagatctcagattttggcacttccaaggagctgagtgacaagagcaccaag
atgtcctttgcagggacagtagcctggatggcccctgaggtgatccgcaatgaacctgtg
tctgagaaggtcgacatctggtcctttggcgtggtgctgtgggaactgctgactggtgag
atcccctacaaagacgtagattcctcagccattatctggggtgtgggaagcaacagtctc
catctgcctgtgccctccagttgcccagatggtttcaagatcctgcttcgccagtgctgg
aatagcaaaccgcgaaatcgcccatcattccgacagatcctgctgcatctggacattgcc
tcagctgatgtactctccacaccccaggagacttactttaagtcccaggcagagtggcgg
gaagaagtaaaactgcactttgaaaagattaagtcagaagggacctgtctgcaccgccta
gaagaggaactggtgatgaggaggagggaggagctcagacacgccctggacatcagggag
cactatgaaaggaagctggagagagccaacaacctgtatatggaacttaatgccctcatg
ttgcagctggaactcaaggagagggagctgctcaggcgagagcaagctttagagcggagg
tgcccaggcctgctgaagccacacccttcccggggcctcctgcatggaaacacaatggag
aagcttatcaagaagaggaatgtgccacagaagctgtcaccccatagcaaaaggccagat
atcctcaagacggagtctttgctccctaaactagatgcagccctgagtggggttgggctt
cctgggtgtcctaagggccccccctcaccaggacggagtcgccgtggcaagacccgtcac
cgcaaggccagcgccaaggggagctgtggggacctgcctgggcttcgtacagctgtgcca
ccccatgaacctggaggaccaggaagcccagggggcctaggagggggaccctcagcctgg
gaggcctgccctcccgccctccgtgggcttcatcatgacctcctgctccgcaaaatgtct
tcatcgtccccagacctgctgtcagcagcactagggtcccggggccggggggccacaggc
ggagctggggatcctggctcaccacctccggcccggggtgacaccccaccaagtgagggc
tcagcccctggctccaccagcccagattcacctgggggagccaaaggggaaccacctcct
ccagtagggcctggtgaaggtgtggggcttctggtaactggaagggaagggacctcaggc
cggggaggaagccgggctgggtcccagcacttgaccccagctgcactgctgtacagggct
gccgtcacccgaagtcagaaacgtggcatctcatcggaagaggaggaaggagaggtagac
agtgaagtagagctgacatcaagccagaggtggcctcagagcctgaacatgcgccagtca
ctatctaccttcagctcagagaatccatcagatggggaggaaggcacagctagtgaacct
tcccccagcggcacacctgaagttggcagcaccaacactgatgagcggccagatgagcgg
tctgatgacatgtgctcccagggctcagaaatcccactggacccacctccttcagaggtc
atccctggccctgaacccagctccctgcccattccacaccaggaacttctcagaggagag
cggggccctcccaattctgaggactcagactgtgacagcactgaattggacaactccaac
agcgttgatgccttgcggcccccagcttccctccctccatga

DBGET integrated database retrieval system