KEGG   Pan paniscus (bonobo): 100983391Help
Entry
100983391         CDS       T02283                                 

Gene name
UNC13B
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
pps  Pan paniscus (bonobo)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:pps04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1591 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEEDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMKR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNMQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcgctgaagactattcgtcagtcagatgaggaagggcctggggaatggtccacattagag
gcagagacgttaatgaaagacgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccagaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgccgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcttccca
cctccttaccatacagcttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
cgatcgccacagcagctgctacttcaaggcagttcccgggactcttgtaatgactctatg
caaagttatgaccttgattatccagagcggcgggctatcagccccaccagcagcagtagg
tatggctcctcctgtaatgtgagtcaaggaagctctcagctaagtgaactagaccagtat
cacgaagaagatgacgaccatcgggagacagactcgattcattcttgccacagctctcac
agcctgtccagagatggccaagcaggttttggagaacaagagaaacccttggaggtgaca
ggtcaagcagagaaggaggcagcatgtgaacccaaggagatgaaagaagatgccacaacc
caccctcccccagatctggtgctgcaaaaagaccacttcctaggtccccaggagagtttt
cctgaggagaatgcatcttcaccatttacccaagccagagcacattggatccgagcagtt
accaaggttcgactccagctgcaggagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctgtcactggtccagtctcggaaggcagga
atcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcccacgtg
tataagaaaaccctgcaggccttaatctaccccatttcgtgcaccactcctcataacttt
gaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctctggggc
attgcccggcagggcatgcgctgcagcgaatgtggagtcaagtgccatgagaagtgccag
gatctgctcaatgctgactgcctgcagcgggctgcagaaaagagctgtaaacatggagct
gaggaccggacccagaacattatcatggccatgaaggaccgcatgaagatccgagagcga
aataagccagagatctttgaagttatccgggacgtcttcacagtgaacaaagctgcccat
gtgcagcagatgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcagcc
aagatcaccattactgtggtgtgtgcccagggcctacaagccaaggacaaaacaggatcc
agtgacccttacgtgactgtgcaagtcagcaaaactaagaagcgtaccaagaccattttt
ggaaacttgaatcctgtttgggaggagaagttccattttgagtgccacaactcctctgac
cgcattaaggtgcgtgtatgggatgaggatgatgacatcaagtcaagagtaaagcaacgc
ctaaagcgagagtctgatgatttccttggccaaaccatcattgaggttcggaccctaagt
ggcgagatggacgtctggtacaacttggagaagaggacagacaaatcagccgtctcaggg
gctatccgactacaaatcagtgtggagatcaagggggaggagaaggtagccccataccac
gtgcagtatacgtgtctccatgagaatcttttccattacctcacagacattcagggcagt
ggaggagtccgcatccctgaagctcgaggagacgatgcctggaaggtgtactttgatgag
acagcccaagaaattgtggatgaatttgccatgcgttatggcattgagtccatatatcag
gccatgacgcactttgcatgtttatcatccaagtacatgtgtcctggtgtgccagcagtg
atgagcaccttactggccaacatcaatgcctactatgcccacacaactgcctctaccaat
gtctctgcatctgatcgctttgcagcctccaactttgggaaagagagatttgtaaaactg
ctggaccagctacacaactcactgaggatcgacctctctacatacaggaataatttccct
gctgggagtcctgaacggcttcaggacttaaaatccacagtggatttgctgaccagcatt
actttcttcagaatgaaggtacaagaactgcaaagccctccaagagccagccaggtggta
aaggattgtgtgaaggcctgtttgaactccacatatgaatatatcttcaacaactgccac
gacttatacagccgccagtaccagctgaagcaggagctacctccagaggaacaagggccc
agcattcggaacctggatttctggcccaagctcatcacactcatcgtgtcaatcatagag
gaagataagaattcctacacacctgttctgaaccagtttcctcaggagttgaatgtggga
aaagtcagcgcagaagtgatgtggcatttgtttgcccaagacatgaaatatgcattggag
gagcatgagaaagaccatctgtgtaaaagtgctgactacatgaacctgcacttcaaggtg
aagtggctccacaatgaatacgtgcgggatctgcctgtcctccaggggcaggtgcctgag
tacccagcgtggtttgagcagttcgtgctacaatggctggatgagaatgaggatgtatcc
ctggaattcctgcgtggggccctggaacgagataagaaggatggattccagcagacatca
gagcatgcactcttttcctgctctgtggtggatgtcttcacacaactcaatcagagcttt
gagatcatccggaagctggaatgcccagaccccagcatccttgcccactacatgaagagg
tttgctaagaccatcgggaaagtgctgatgcagtatgcagacatcttgtcaaaggacttc
ccagcctattgcacaaaggagaaactgccctgcatcctgatgaacaatatgcagcaactg
agggtccagctggagaaaatgtttgaggccatgggaggcaaggagctggaccttgaagct
gcagacagtctgaaggagctgcaagtgaaactgaatacggttctggatgagctcagcatg
gtgtttggaaacagtttccaggtacggattgatgagtgtgttcgacaaatggccgacatc
ctgggccaggttcggggcacagggaatgcatctccagacgccagggcctcagcggctcag
gatgcagatagtgtactccggcctctcatggacttcctggatggcaacctcaccctcttt
gccactgtgtgtgagaagacggttctgaagcgtgtactgaaggagctctggcgcgtggtg
atgaacacaatggagaggatgattgttctgcccccactcactgaccagacgggcacccag
ctgatcttcactgctgccaaggagctgagccatctttccaaactcaaggatcacatggta
cgagaggaaacacggaatctcactccaaagcagtgtgcagtccttgacctcgccctggac
accatcaagcaatacttccatgcaggaggcaatgggctgaagaaaaccttcctggagaag
agcccagatctgcagtctctacgctatgccctgtctctgtacacacagactactgacact
ctcatcaagacctttgtgcgctcgcagaccacccaagggtctggtgtggacgatcctgtg
ggagaagtctctattcaggtggacttgtttacacaccctggtactggggagcacaaggtc
acagtgaaagtggtggctgccaatgacctcaagtggcagacagcgggtatgttccggcct
ttcgtggaggtgactatggttggcccacaccaaagtgataagaagaggaagttcacaacc
aaatccaaaagcaacaactgggcccccaagtacaatgagacattccacttcctcctggga
aatgaagaggggcccgagtcctatgagttgcagatatgcgtgaaggattactgctttgcc
cgggaagatcgcgtgctagggctggctgtgatgcctctgagggatgtcacagccaagggc
agctgtgcctgctggtgccccttgggtcggaagatccatatggatgagacaggcctgacc
attctccggattttgtctcagaggagcaatgacgaggtggcccgagaatttgtgaaactc
aaatcagagtctcgttccacggaggaggggagctga

DBGET integrated database retrieval system