KEGG   Pan paniscus (bonobo): 100983465Help
Entry
100983465         CDS       T02283                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00020  Citrate cycle (TCA cycle)
pps00310  Lysine degradation
pps01100  Metabolic pathways
pps01200  Carbon metabolism
Module
pps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pps_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100983465 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100983465 (DLST)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100983465 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 DUF4106 GCV_H
Motif
Other DBs
NCBI-GeneID: 100983465
NCBI-ProteinID: XP_003824220
Position
14
AA seq 453 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFF
RTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPI
PTQMPPVPSPSQPPSGKPVSAVKPTVTPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKE
AQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNA
VIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELA
IEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgtgtgtcccgggcgttcagccgctcgctctccgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgccagggacca
ggttaccctaacagcaggaaggttgtcattaacaacagtgtcttcagtgttcgctttttc
agaactacagctgtatgcaaggatgacttggttacagtcaaaaccccagcgtttgcagaa
tctgtcacagagggagatgtcaggtgggagaaagctgttggagacacagttgcagaagat
gaagtagtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagcaaat
ggcgtgattgaagctcttttggtacctgatgggggaaaagtcgaaggaggcactccactt
ttcacactcaggaaaactggtgctgctcctgctaaggccaagccggctgaagctcctgct
gctgcagcaccaaaagcagaacctacagcagcggcagttcctccccctgcagcacccata
cccactcagatgccaccagtgccctcgccctcacagcctccttctggcaaacctgtgtct
gcagtaaaacccactgtcaccccaccactagctgagccaggagctggcaaaggtctgcgt
tcagaacatcgggagaaaatgaacaggatgcggcagcgcattgctcagcgtctgaaggag
gcccagaatacatgtgcaatgctgacaacttttaatgagattgacatgagtaacatccag
gagatgagggctcggcacaaagaggcttttttgaagaaacataacctcaaactaggcttc
atgtcggcatttgtgaaggcctcagcctttgccttgcaggaacagcctgttgtaaatgca
gtgattgacgacacaaccaaagaggtggtgtatagggattatattgacatcagtgttgca
gtggccaccccacggggtctggtggttccagtcatcaggaatgtggaagctatgaatttt
gcagatattgaacggaccatcactgaactgggagagaaggcccgaaagaatgaacttgcc
attgaagatatggatggcggtaccttcaccattagcaatggaggcgtttttggctcactc
tttggaacacccattatcaacccccctcaatctgccatcctggggatgcatggcatcttt
gacaggccagtggctataggaggcaaggtagaggtgcggcccatgatgtacgtggcactg
acctatgatcaccggctgattgatggcagagaggctgtgactttcctccgcaaaatcaag
gcagcggtagaggatcccagagtcctcctcctggatctttag

DBGET integrated database retrieval system