KEGG   Pan paniscus (bonobo): 100983465Help
Entry
100983465         CDS       T02283                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pps  Pan paniscus (bonobo)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pps01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pps00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pps00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 453 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFF
RTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPI
PTQMPPVPSPSQPPSGKPVSAVKPTVTPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKE
AQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNA
VIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELA
IEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgtgtgtcccgggcgttcagccgctcgctctccgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgccagggacca
ggttaccctaacagcaggaaggttgtcattaacaacagtgtcttcagtgttcgctttttc
agaactacagctgtatgcaaggatgacttggttacagtcaaaaccccagcgtttgcagaa
tctgtcacagagggagatgtcaggtgggagaaagctgttggagacacagttgcagaagat
gaagtagtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagcaaat
ggcgtgattgaagctcttttggtacctgatgggggaaaagtcgaaggaggcactccactt
ttcacactcaggaaaactggtgctgctcctgctaaggccaagccggctgaagctcctgct
gctgcagcaccaaaagcagaacctacagcagcggcagttcctccccctgcagcacccata
cccactcagatgccaccagtgccctcgccctcacagcctccttctggcaaacctgtgtct
gcagtaaaacccactgtcaccccaccactagctgagccaggagctggcaaaggtctgcgt
tcagaacatcgggagaaaatgaacaggatgcggcagcgcattgctcagcgtctgaaggag
gcccagaatacatgtgcaatgctgacaacttttaatgagattgacatgagtaacatccag
gagatgagggctcggcacaaagaggcttttttgaagaaacataacctcaaactaggcttc
atgtcggcatttgtgaaggcctcagcctttgccttgcaggaacagcctgttgtaaatgca
gtgattgacgacacaaccaaagaggtggtgtatagggattatattgacatcagtgttgca
gtggccaccccacggggtctggtggttccagtcatcaggaatgtggaagctatgaatttt
gcagatattgaacggaccatcactgaactgggagagaaggcccgaaagaatgaacttgcc
attgaagatatggatggcggtaccttcaccattagcaatggaggcgtttttggctcactc
tttggaacacccattatcaacccccctcaatctgccatcctggggatgcatggcatcttt
gacaggccagtggctataggaggcaaggtagaggtgcggcccatgatgtacgtggcactg
acctatgatcaccggctgattgatggcagagaggctgtgactttcctccgcaaaatcaag
gcagcggtagaggatcccagagtcctcctcctggatctttag

DBGET integrated database retrieval system