KEGG   Pan paniscus (bonobo): 100983567Help
Entry
100983567         CDS       T02283                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1082 aa AA seqDB search
MSSSVTSECYNLTPPPHPSSTALFQEKTGNLCQLFKYEFGDEKLYICHTKLADRYPQSCQ
MLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSA
ANKEVLAMIDLTHDNKDDLQAAIALSLLESPKIQADGRDLNRMHEATSAETKRSKRKRCE
VWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLENC
RSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSSEEQQQDVSEFTHKL
LDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEGVREGKPFCNNETFGQYPLQVNGY
RNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLPPVLTFELSRFEFNQSLGQPEKIH
NKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIKILQQKLERYVKYGSGPARFPLPD
MLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSVSDQTSKESTSTESSSQDVQSTFS
SPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINFVKTCLQRWRSEIEQDIQDLKNCI
ASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYWAYIYNQPRQSWLKYNDISVTE
SSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAAPTESDQMSEVEALSVELKHYIQE
DNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDYSTSQEPSVASSHGVRCLSSEHAVIVK
EQTAQAIANTARAYEKSGVEAALSEAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQN
EAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLF
RKVSVYLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLE
LNAKAASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLG
QDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVT
VK
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctagtgttacttcggaatgttataacttaacaccacctcctcacccctcaagt
actgcactttttcaagagaaaacgggaaatctgtgccagttgttcaaatacgagtttgga
gatgagaaactttatatttgtcatacaaagctggcagacagataccctcagagctgccaa
atgctgttaaatcaactgagagaaatcacaggcattcaggacccttcctttctccatgaa
gctctgaaggccagtaatggtgacattactcaggcagtcagccttctcactgatgagaga
gttaaggagcccagtcaagacactgttgctacagaaccatctgaagtagaggggagtgct
gccaacaaggaagtattagcaatgatagaccttactcatgataacaaagatgatcttcag
gctgccattgctttgagtctactggagtctcccaaaattcaagctgatggaagagatctt
aacaggatgcatgaagcaacctctgcagaaactaaacgctcaaagagaaaacgctgtgaa
gtctggggagaaaaccccaatcccaatgactggaggagagttgatggttggccagttggg
ctgaaaaatgttggcaatacatgttggtttagtgctgttattcagtctctctttcaattg
cctgaatttcgaagacttgttctcagttatagtctgccacaaaatgtacttgaaaattgt
cgaagtcatacagaaaagagaaatatcatgtttatgcaagagcttcagtatttgtttgct
ctaatgatgggatcaaatagaaaatttgtagacccatctgcagccctggatctattaaag
ggagcattccgatcatctgaggaacagcagcaagatgtgagtgaattcacacacaagctc
ctggattggctagaggacgcattccagctagctgttaatgttaacagtcccaggaacaaa
tctgaaaatccaatggtgcagctgttctatggtactttcctgactgaaggggttcgtgaa
ggaaaacccttttgtaacaatgagaccttcggccagtatcctcttcaggtaaacggttat
cgcaacttagacgagtgtttggaaggggccatggtggagggtgatgttgagcttcttccc
tccgatcactcggtgaagtatggacaagagcgttggtttacaaagctacctccagtgttg
acctttgaactctcaagatttgagtttaatcagtcccttgggcagccagagaaaattcac
aataagctggaatttcctcagattatttatatggacaggtacatgtacaggagcaaggag
cttattcgaaataagagagagtgtattcgaaagttgaaggaggaaataaaaattctgcag
caaaaattggaaaggtatgtgaaatatggctcaggcccagctcggttcccgctcccggac
atgctgaaatatgttattgaatttgctagtacaaaacctgcctcagaaagctgtccacct
gaaagtgacacacatatgacattaccactttcttcagtgcactgctcggtttctgaccag
acatccaaggaaagtacaagtacagaaagctcttctcaggatgttcaaagtaccttttct
tctcctgaagattctttacccaagtctaaaccactgacatcttctcggtcttccatggaa
atgccttcacagccagctccacgaacagtcacagatgaggagataaattttgttaagacc
tgtcttcagagatggaggagtgagattgaacaagatatacaagatttaaagaattgtatt
gcaagtactactcagactattgaacagatgtactgcgatcctctccttcgtcaggtgcct
tatcgcttgcatgcagttcttgttcatgaaggacaagcaaatgctggacactattgggcc
tatatctataatcaaccccgacagagctggctcaagtacaatgacatctctgttactgaa
tcttcctgggaagaagttgaaagagattcctatggaggcctgagaaatgttagtgcttac
tgtctgatgtacattaatgacaaactaccctacttcaatgcagaggcagccccaactgaa
tcagatcaaatgtcagaagtggaagccctatctgtggaactcaagcattacattcaggag
gataactggcggtttgagcaggaagtagaggagtgggaagaagagcagtcttgcaaaatc
cctcaaatggagtcctccaccaactcctcatcacaggactactctacatcacaagagcct
tcagtagcctcttctcatggggttcgctgcttgtcatctgagcatgctgtgattgtaaag
gagcaaactgcccaggctattgcaaacacagcccgtgcctatgagaagagcggtgtagaa
gcggcactgagtgaggcattccatgaagaatactccaggctctatcagcttgccaaagag
acccccacctctcacagtgatcctcgacttcagcatgtccttgtctactttttccaaaat
gaagcacccaaaagggtagtagaacgaacccttctggaacagtttgcagataaaaatctt
agctatgatgaaagatcaatcagcattatgaaggtggctcaagcgaaactgaaggaaatt
ggtccagatgacatgaatatggaagagtacaagaagtggcatgaagattatagtttgttc
cgaaaagtgtctgtgtatctcctaacaggcctagaactctatcaaaaaggaaagtaccaa
gaggcactttcctacctggtatatgcctaccagagcaatgccgccctgctgatgaagggg
ccccgccggggggtcaaagaatccgtgattgctttataccgaagaaaatgccttctggag
ctgaatgccaaagcagcttctctttttgaaacaaatgatgatcactccgtaactgagggc
attaatgtgatgaatgaactgatcatcccctgcattcaccttatcattaataatgacatt
tccaaggatgatctggatgccattgaggtcatgagaaaccattggtgctcttaccttggg
caagatattgcagaaaatctgcagctgtgcctaggggagtttctacccagacttctagat
ccttctgcagaaatcatcgtcttgaaagagcctccaactattcgacccaattctccctat
gacctatgtagccgatttgcagctgtcatggagtcaattcagggagtttcaactgtgaca
gtgaaataa

DBGET integrated database retrieval system