KEGG   Pan paniscus (bonobo): 100983596Help
Entry
100983596         CDS       T02283                                 

Gene name
PFN1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100983596 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100983596 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100983596 (PFN1)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100983596 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

DBGET integrated database retrieval system