KEGG   Pan paniscus (bonobo): 100983596Help
Entry
100983596         CDS       T02283                                 

Definition
profilin-1-like
Orthology
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pps04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pps04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:pps05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

DBGET integrated database retrieval system