KEGG   Pan paniscus (bonobo): 100983649Help
Entry
100983649         CDS       T02283                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04015  Rap1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05014  Amyotrophic lateral sclerosis (ALS)
pps05132  Salmonella infection
pps05133  Pertussis
pps05140  Leishmaniasis
pps05142  Chagas disease (American trypanosomiasis)
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05164  Influenza A
pps05167  Kaposi's sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05205  Proteoglycans in cancer
pps05418  Fluid shear stress and atherosclerosis
Module
pps_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100983649 (MAPK14)
   04010 MAPK signaling pathway
    100983649 (MAPK14)
   04370 VEGF signaling pathway
    100983649 (MAPK14)
   04668 TNF signaling pathway
    100983649 (MAPK14)
   04068 FoxO signaling pathway
    100983649 (MAPK14)
   04071 Sphingolipid signaling pathway
    100983649 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100983649 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100983649 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100983649 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100983649 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100983649 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100983649 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100983649 (MAPK14)
   04660 T cell receptor signaling pathway
    100983649 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100983649 (MAPK14)
   04659 Th17 cell differentiation
    100983649 (MAPK14)
   04657 IL-17 signaling pathway
    100983649 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100983649 (MAPK14)
   04670 Leukocyte transendothelial migration
    100983649 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    100983649 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100983649 (MAPK14)
   04917 Prolactin signaling pathway
    100983649 (MAPK14)
   04926 Relaxin signaling pathway
    100983649 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100983649 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    100983649 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100983649 (MAPK14)
   04722 Neurotrophin signaling pathway
    100983649 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100983649 (MAPK14)
  Development
   04380 Osteoclast differentiation
    100983649 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    100983649 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100983649 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100983649 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100983649 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100983649 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    100983649 (MAPK14)
   05133 Pertussis
    100983649 (MAPK14)
   05152 Tuberculosis
    100983649 (MAPK14)
   05164 Influenza A
    100983649 (MAPK14)
   05160 Hepatitis C
    100983649 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100983649 (MAPK14)
   05169 Epstein-Barr virus infection
    100983649 (MAPK14)
   05145 Toxoplasmosis
    100983649 (MAPK14)
   05140 Leishmaniasis
    100983649 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    100983649 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    100983649 (MAPK14)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100983649 (MAPK14)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100983649 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 100983649
NCBI-ProteinID: XP_003818964
Position
6
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcaaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccaaagatgaactttgcgaatgtatttattggtgccaatccgctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system