KEGG   Pan paniscus (bonobo): 100983759Help
Entry
100983759         CDS       T02283                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100983759 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100983759 (MGST1)
   00982 Drug metabolism - cytochrome P450
    100983759 (MGST1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100983759 (MGST1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100983759 (MGST1)
  Drug resistance
   01524 Platinum drug resistance
    100983759 (MGST1)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100983759 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcgtcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttgagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

DBGET integrated database retrieval system