KEGG   Pan paniscus (bonobo): 100983866Help
Entry
100983866         CDS       T02283                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100983866 (BDNF)
   04024 cAMP signaling pathway
    100983866 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100983866 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100983866 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100983866 (BDNF)
   05034 Alcoholism
    100983866 (BDNF)
Cytokines [BR:pps04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100983866 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 262 aa AA seqDB search
MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLES
VNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPP
LLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVT
VLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKR
IGWRFIRIDTSCVCTLTIKRGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccgggaagaggaatggttccaccaggtgagaagagtgatgaccatccttttc
cttactatggttatttcatacttcggttgcatgaaggctgcccccatgaaagaagcaaac
atccgaggacaaggtggcttggcctacccaggtgtgcggacccatgggactctggagagc
gtgaatgggcccaaggcaggttcaagaggcttgacatcgttggctgacactttcgaacac
gtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaacaataag
gacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggagcctcct
cttctctttctgctggaggaatacaaaaattacctagatgctgcaaacatgtccatgagg
gtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagtattagc
gagtgggtaacggcggcggacaaaaagactgcagtggacatgtcgggcgggacggtcaca
gtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatacttctacgagaccaag
tgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcattggaac
tcccagtgccgaactacccagtcgtacgtgcgggcccttaccatggatagcaaaaagaga
attggctggcgattcataaggatagacacttcttgtgtatgtacattgaccattaaaagg
ggaagatag

DBGET integrated database retrieval system