KEGG   Pan paniscus (bonobo): 100983945Help
Entry
100983945         CDS       T02283                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  
replication factor A2
Organism
pps  Pan paniscus (bonobo)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100983945 (RPA2)
   03420 Nucleotide excision repair
    100983945 (RPA2)
   03430 Mismatch repair
    100983945 (RPA2)
   03440 Homologous recombination
    100983945 (RPA2)
   03460 Fanconi anemia pathway
    100983945 (RPA2)
DNA replication proteins [BR:pps03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100983945 (RPA2)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100983945 (RPA2)
   MMR (mismatch exicision repair)
     100983945 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100983945 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 343 aa AA seqDB search
MGREDRNKRSIREHRLAEASTPXELTGSAIRWKEFVAPEKSSQSSAVAAAFCGFPLFPQT
RTFSASLRRIVTKMWNSGFENYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIV
PCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQW
VDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHM
VLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF
QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagaagacaggaacaagcgtagcattcgtgagcaccgattggctgaagcgagc
accccgnnggagctgactggctccgccattcgctggaaggagtttgtggcgccagagaaa
agtagccagagcagcgcagtggcggccgcgttctgtggttttccgctattcccccagacc
cgcaccttctcggcctctttgcggagaatcgtgaccaagatgtggaacagtggattcgaa
aactatggcagctcctcatacgggggagccggcggctacacgcagtccccggggggcttt
ggatcgcctgcaccttctcaagccgaaaagaaatcaagagcccgagcccagcacattgtg
ccctgtactatatctcagctgctttctgccactttggttgatgaagtgttcagaattggg
aatgttgagatttcacaggtcactattgtggggatcatcagacatgcagagaaggctcca
accaacattgtttacaaaatagatgacatgacagctgcacccatggacgttcgccagtgg
gttgacacagatgacaccagcagtgaaaacactgtggttcctccagaaacatatgtgaaa
gtggcaggccacctgagatcttttcagaacaaaaagagcctggtagcctttaagatcatg
cccctggaggatatgaatgagttcaccacacatattctggaagtgatcaatgcacacatg
gtactaagcaaagccaacagccagccctcagcagggagagcacctatcagcaatccagga
atgagcgaagcagggaactttggtgggaatagcttcatgccagcaaatggcctcactgtg
gcccaaaaccaggtgttgaatttgattaaggcttgtccaagacctgaagggttgaacttt
caggatctcaagaaccagctgaaacacatgtctgtatcctcaatcaagcaagctgtggat
tttctgagcaatgaggggcacatctattctactgtggatgatgaccattttaaatccaca
gatgcagaataa

DBGET integrated database retrieval system