KEGG   Pan paniscus (bonobo): 100984694Help
Entry
100984694         CDS       T02283                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04072  Phospholipase D signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04611  Platelet activation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04722  Neurotrophin signaling pathway
pps04750  Inflammatory mediator regulation of TRP channels
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05167  Kaposi's sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100984694 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100984694 (PLCG2)
   04012 ErbB signaling pathway
    100984694 (PLCG2)
   04370 VEGF signaling pathway
    100984694 (PLCG2)
   04064 NF-kappa B signaling pathway
    100984694 (PLCG2)
   04066 HIF-1 signaling pathway
    100984694 (PLCG2)
   04020 Calcium signaling pathway
    100984694 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100984694 (PLCG2)
   04072 Phospholipase D signaling pathway
    100984694 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100984694 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100984694 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100984694 (PLCG2)
   04662 B cell receptor signaling pathway
    100984694 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100984694 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100984694 (PLCG2)
   04670 Leukocyte transendothelial migration
    100984694 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100984694 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100984694 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100984694 (PLCG2)
  Development
   04360 Axon guidance
    100984694 (PLCG2)
   04380 Osteoclast differentiation
    100984694 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100984694 (PLCG2)
   05206 MicroRNAs in cancer
    100984694 (PLCG2)
   05205 Proteoglycans in cancer
    100984694 (PLCG2)
   05225 Hepatocellular carcinoma
    100984694 (PLCG2)
   05214 Glioma
    100984694 (PLCG2)
   05223 Non-small cell lung cancer
    100984694 (PLCG2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100984694 (PLCG2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100984694 (PLCG2)
   05169 Epstein-Barr virus infection
    100984694 (PLCG2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100984694 (PLCG2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100984694 (PLCG2)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100984694 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100984694 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 EF-hand_like GDPD
Motif
Other DBs
NCBI-GeneID: 100984694
NCBI-ProteinID: XP_003820933
Position
16
AA seq 1265 aa AA seqDB search
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacggtcaatgtagattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtccacccccgagcgg
agaaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagaccgctgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gatttcgagcgagcaaaagcagttcgccagaaagaagactgctgcttcactatcctgtat
ggcactcagttcgtcctcagcacgctcagcttggcggctgactctaaagaggatgcagtt
aactggctctctggcttgaaaatcttacaccaggaagcgatgaatgcgtccacgcccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagtctccgagagttgaagaccatcttgcccctgatcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtccgtgttcatcctggggaacactgacaggccggatgcctctgct
gtttacctgcatgacttccagaggtttctcatacatgaacagcaggagcattgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacaccatgcgtgaaact
gctgagcctttcttgtttgtggatgagttcctcacgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgcggtggacatgcaggacatgaacaaccccctgtctcat
tactggatctcctcgtcacataacacgtaccttacaggtgaccagctgcggagcgagtcg
tccccagaagcttacatccgctgcctgcgcatgggctgtcgctgcattgaactggactgc
tgggacgggccggatgggaagccggtcatctaccatggctggacgcggactaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccacgcctttgttacctcgagcttccca
gtgatcctgtccatcgaggagcactgcagcgtggagcaacagcgtcacatggccaaggcc
ttcaaggaagtgtttggcgacctgctgctgacgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacatggaggacaagaaggacgaacacaagcaacagggagag
ctgtacatgtgggattccattgaccagaaatggactcggcactactgcgccatcgccgat
gccaagctgtccttcagtgatgacattgaacagactatggaggaggaagtgccccaggat
ataccccctacagaactacattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgccgagaagttgctgcaggaatactgcatggagacggggggcaaggatggcacc
ttcctggttcgggagagcgagaccttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgctccaccatggagggcgggaccctgaaatactac
ttgactgacaacctcaccttcagcagcatctatgccctcatccagcactaccgcgagaca
cacctgcgctgcgccgagttcgagctgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgacagcctgagccgcggagaggcagaggacatgctg
atgaggattccccgggacggggccttcctgatccggaagcgagaggggagcgactcctat
gccatcacgttcagggctaggggcaaggtaaagcattgtcgcatcaaccgggatggccgg
cactttgtgctggggacctccgcctattttgagagtctggtggagctcgtcagttactac
gagaagcattcactctaccgaaagatgagactgcgctaccccgtgacccccgagctcctg
gagcgctacaatatggaaagagatataaactccctctacgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggtgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccaggatccagcagtacttccca
tccaactacgtcgaggacatctcaactgcagacttcgaggagctagaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaatacctataacgtc
gtgaaagcccctcagggaaaaaaccagaagtcctttgtcttcatcctggagcccaagaag
cagggcgatcctccggtggagtttgccacagacagggtggaggagctctttgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgacctggttgtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcatcatcagacagaagcccgttgacctcctgaagtacaatcaaaag
ggcctgacccgcgtctacccaaagggacaaagagttgactcttcaaactacgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacgccagataagtac
atgcagatgaatcacgcgttgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccgatgccacccgagtcccagaggaagatcctg
atgacgctgacagtcaaggttctcggtgctcgccatctccccaaacttggacgaagtatt
gcctgtccctttgtagaagtggagatctgtggagccgagtatgacaacaacaagttcaag
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgctttgtggtttatgaagaagat
atgttcagcgatcccaactttcttgctcatgccacttaccccattaaagcaatcaaatca
ggattcaggtccgttcctctgaagaatgggtacagcgaggacatagagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctgaggaggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcagtgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcatag

DBGET integrated database retrieval system