KEGG   Pan paniscus (bonobo): 100985141Help
Entry
100985141         CDS       T02283                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00071  Fatty acid degradation
pps00280  Valine, leucine and isoleucine degradation
pps00310  Lysine degradation
pps00380  Tryptophan metabolism
pps00410  beta-Alanine metabolism
pps00640  Propanoate metabolism
pps00650  Butanoate metabolism
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps01212  Fatty acid metabolism
pps03320  PPAR signaling pathway
pps04146  Peroxisome
Module
pps_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
pps_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100985141 (EHHADH)
   00650 Butanoate metabolism
    100985141 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    100985141 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100985141 (EHHADH)
   00310 Lysine degradation
    100985141 (EHHADH)
   00380 Tryptophan metabolism
    100985141 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100985141 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100985141 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100985141 (EHHADH)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100985141 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100985141 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     100985141 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 Peptidase_S49 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 100985141
NCBI-ProteinID: XP_003806653
Position
3
AA seq 723 aa AA seqDB search
MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQV
GLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEE
AIRFAQRVSDQPLESRRLCNKPIQSLPYMDSIFSEALLKMRRQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLLQSGQARALQHAFFAERKANKWSTPSGASWKTASARPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLAIANKMITSVLEKEASKMQQSGHPWSG
PKPRLTSSMKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLPPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SQYRETHHIEPRTISQDEILERCLYSLINEAFCILGEGIAASPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtatacgcggctgcacaacgccttggcgctgatccgcctccgaaacccgccg
gtcaacgcgatcagtacgactttactccgtgacataaaagaaggactacagaaagctgta
atagaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggt
gctgatattcgtggcttcagtgctcctaggacatttggccttacactgggacatgtagta
gatgaaatacagagaaatgagaagcccgtggtggcagcaatccaaggcatggctttcgga
gggggactagagctggccctgggctgtcactataggattgcccacgcagaggctcaagtt
ggcttaccagaagttacactgggacttctccctggtgcaagaggaacccagcttctcccc
agactcactggagttcctgctgcacttgacttaattacctcaggaagacgtattttagca
gatgaagcactcaagctgggcattctagataaagttgtaaactcagacccggttgaagaa
gcaatcagatttgctcagagagtttcagatcaacctctagaatcccgtagactctgcaac
aagccaattcagagcttgccctacatggacagcatttttagtgaggccctcttgaagatg
cggaggcagcaccctgggtgtcttgcacaggaggcttgtgtccgtgcagtccaggctgct
gtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgtttctatatcttttg
caatcagggcaggctagagccctgcaacatgctttcttcgctgaaaggaaagcaaataag
tggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcctgtctcctcagtt
ggtgttgttggcttgggaacaatgggccgaggcattgtcatttcttttgcaagggccagg
attcctgtgattgctgtagactcggacaaaaaccagctagcaattgcaaacaagatgata
acctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccacccttggtcagga
ccaaaacccaggttaacttcatctatgaaggagcttggtggtgtagatttagtcattgaa
gcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactctcagctgtgtgc
aaaccagaagcatttttgtgcactaatacttcagccctggatgttgatgagattgcttct
tccactgatcgtcctcacttggtcattggcacccacttcttttcgccagctcatgtcatg
aagttgttagaggttattcccagccaatactcttcccccactaccattgccactgttatg
aacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttattacaatcaggcatatttcttgttagaagaaggcagc
aaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatgggaccttttaga
gtgtctgatcttgctgggttggatgtgggctggaaatctagaaaggggcaaggtcttact
ggacctacattgcctccaggaactcctgcccgaaaaaggggtaataggaggtactgccca
attcctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggttggtat
caatatgacaagccattgggtaggattcacaaacctgatccctggctttccaaattccta
tcacagtatagagaaacccatcacattgaaccacgtaccattagccaggatgagatcctc
gagcgctgcttatattcacttatcaatgaagcattctgtatcttgggagaagggatagct
gctagcccagagcacattgatgttgtctatttacatggatatggatggccaaggcacaag
ggcgggcccatgttctatgcttccacagttgggttgcccacagttctagagaaattgcag
aaatattacaggcagaaccctgatattccccaactggagccaagtgactatctaaaaaaa
ctggcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggctcccctagc
agtaaattgtga

DBGET integrated database retrieval system