KEGG   Pan paniscus (bonobo): 100985385Help
Entry
100985385         CDS       T02283                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100985385 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 278 aa AA seqDB search
ARSGGSGGDGSNSGSYSGDASGAVTVWEVVSLLGKLLGTVVALKVVLYLLRVCLAMAWKS
GGASHSELIHNLRSSSDPPTLASHSAGIIGMSHRTQPFTPFYENGIIKTDKVFEVMLATD
RSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACF
ARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAI
HVGAAAPVVPQACLASMKKMLGIDCISKTDSIGAKGSN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gcgcgcagtggcggcagcggcggcgacggcagtaacagcggcagctacagcggggacgcg
agcggggcggtgacggtgtgggaggtggtctcactcttgggaaaactgctgggcaccgtc
gtcgcgctgaaggtggttctgtacctgctccgagtgtgcttagcgatggcctggaaatcc
ggcggcgccagccactcggagctgatccacaatctccgcagctcaagtgatcctcctacc
ttggcctcccacagtgctgggattataggcatgagtcaccgcacccagccgttcactcct
ttttatgaaaatggaatcatcaagacagataaagtatttgaagtgatgctggctacagac
cgctcccactatgcaaaatgtaacccatacatggattctccacaatcaataggtttccaa
gcaacaatcagtgctccacacatgcatgcatatgcgctagaacttctatttgatcagttg
catgaaggagctaaagctcttgatgtaggatctggaagtggaatccttactgcatgtttt
gcacgtatggttggatgtactggaaaagtcataggaattgatcacattaaagagctagta
gatgactcaataaataatgtcaggaaggacgatccaacacttctgtcttcagggagagta
cagcttgttgtgggggatggaagaatgggatatgctgaagaagccccttatgatgccatt
catgtgggagctgcagcccctgttgtaccccaggcgtgccttgcatctatgaaaaagatg
ttaggaattgactgcatttccaagactgacagtattggtgctaagggatccaattga

DBGET integrated database retrieval system