KEGG   Pan paniscus (bonobo): 100985431Help
Entry
100985431         CDS       T02283                                 

Gene name
THBS3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
pps  Pan paniscus (bonobo)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:pps04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:pps04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:pps04510]
Human Diseases; Infectious diseases; Malaria [PATH:pps05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 956 aa AA seqDB search
METQELRGALALLLLCFFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctttttcgcatct
gccagtcaggatctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccttgctcactgctggggacatctacctcttatcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacactcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcgggcctggctgatggg
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgccctacat
ctctacgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcggaggtcgatgggctggagattaggactggacagaaggcgtatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcagtgaccaatgcactg
cactccattctaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccag
atcctggtggagctgcgggatgatatacgagaccaggtgaaggaaatgtccctgatccga
aacaccattatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aatccctgcttccgaggtgtggactgcatggaagtgtacgagtacccaggctaccgctgt
gggccctgcccccctggcctgcagggcaacggcacccactgcagtgacatcaatgagtgt
gctcacgctgacccctgtttcccgggctccagctgcatcaacaccatgcccggcttccac
tgtgaggcctgtcctcgagggtacaagggcacacaggtgtctggtgtgggcattgactat
gcccgggccagcaaacaggtctgcaatgacatcgatgaatgcaacgatggcaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgc
cgcctgggtttcctgggcaaccagagccagggctgcctcccagcccggacctgccacagc
ccagcccacagcccctgccacatccatgctcactgtctctttgaacgcaatggtgcagtg
tcctgccagtgtaacgtgggctgggctgggaatgggaacgtgtgtgggactgacacagac
atcgatggctacccagaccaagcactgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgatgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaagaccagcagaactcagatacagattcatttggtgatgcctgtgac
aattgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaacccactacagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgatactaatgaagacagcgatggggatgggcatcaggacaccaaggacaactgccca
cagctgccaaatagctcccagctggactctgataacgatggacttggagatgagtgtgat
ggggatgatgacaatgatggcatcccagattatgtgcctcctggtcctgataactgccgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgcggtggtcgaccccctggatgtgtgtcctgaaagtgcagag
gtaacgcttacggattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggttgtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccctggcttggcagttggatacacggccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactacgcaggctttctcttcagttatcaagac
agtggccgcttctacgtagtcatgtggaagcagaccgagcagacctactggcaggctaca
cccttccgggcggttgcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccgaaatgccctgtggcatactggccacacccctgatcaggtacga
ctgctgtggacagacccacgaaatgtgggctggcgggacaagacctcctatcgctggcag
cttctgcaccggcctcaagttggctacattcgggtgaagctctatgagggaccccagctt
gtggcggattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacataatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagggtgtga

DBGET integrated database retrieval system