KEGG   Pan paniscus (bonobo): 100985436Help
Entry
100985436         CDS       T02283                                 

Gene name
ACACA
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pps  Pan paniscus (bonobo)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100985436 (ACACA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100985436 (ACACA)
   00640 Propanoate metabolism
    100985436 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100985436 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100985436 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100985436 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100985436 (ACACA)
Enzymes [BR:pps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100985436 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100985436 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2383 aa AA seqDB search
MWWSTLMSILRARSFWKWISTQTVRIVRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGS
VSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHIRSSMSGLH
LVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYE
MFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQ
AVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS
GLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRK
VNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQ
VEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRG
HVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW
GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQA
ERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVL
KVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTC
VFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVK
RPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV
MNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMA
QYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHM
KAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTM
LIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESI
FLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL
NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSPTFPEAGHTSLYDEDKVPRD
EPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYE
VDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRAS
ELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCR
AIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHC
TVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGT
VEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLIPIYHQVA
VQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQ
IQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQ
IRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST
NT seq 7152 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtctactctgatgtcaatcttgagggctaggtctttttggaagtggatatct
actcagacagtaagaattgtaagagctgtaagagctcattttggaggaataatggatgaa
ccatctcccttggcccaacctctggagctgaaccagcactctcgattcataataggttcc
gtgtctgaagataactcagaggatgagatcagcaacctggtgaagttggacctactggag
gagaaggagggctccttgtcacctgcttctgttggctcagatacactctctgatttgggg
atctctagcctccaggatggcttggccttgcacataaggtccagcatgtctggcttgcac
ctagtaaagcagggccgagacagaaagaaaatagattctcaacgagatttcactgtggct
tctccagcagaatttgttactcgctttgggggaaataaagtgattgagaaggttcttatt
gctaacaatggcattgcagcagtgaaatgcatgcggtctatccgtaggtggtcttatgaa
atgtttcgaaatgaacgtgcaattagattcgttgtcatggtcacacctgaagaccttaaa
gccaatgcagaatacattaagatggcagatcactatgtgccagtgcctggaggaccaaac
aacaacaactatgcaaatgtggaattaattcttgatattgctaaaaggatcccagtacaa
gcagtgtgggctggctggggtcatgcttctgagaatcccaaactaccggaacttctcttg
aaaaatggcattgccttcatgggtcctccaagccaggccatgtgggctttaggggataag
attgcatcttccatagtggctcaaactgcaggtatcccaactcttccctggagcggcagt
ggtcttcgtgtggactggcaggaaaatgatttttcaaaacgtatcttaaatgttccccag
gagctatatgaaaaaggttatgtgaaagatgtggatgatgggctacaggcagctgaggaa
gttggatatccagtaatgatcaaggcctcagagggtggaggagggaagggaattagaaaa
gtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaagtccctgga
tctcccatatttgtgatgagactagccaaacaatctcgtcatctggaggtgcagatctta
gcggaccaatatggcaatgctatctctttgtttggtcgtgattgctctgtacaacgcagg
catcagaagattattgaagaagcacctgctactattgctactccagcagtatttgaacac
atggaacagtgtgcggtgaaacttgccaaaatggtgggttatgtgagtgctgggactgtg
gaatacctgtacagccaggatggcagcttctactttctggaattgaatcctcggctgcag
gtagagcacccttgtacagagatggtggctgatgtcaatctccctgcagcacagctccag
attgccatggggattcctctatatagaatcaaggatatccgtatgatgtatggggtatct
ccctggggtgattctcccattgattttgaagattctgcacacgttccttgtccaaggggc
catgttattgctgctcggatcactagtgaaaatccagatgagggttttaagcccagctca
ggaacagttcaggagctaaatttccgcagcaataagaatgtttggggatatttcagtgtt
gctgctgcagggggacttcatgaatttgctgattctcagtttggtcactgcttttcttgg
ggagaaaacagagaagaggcaatttcaaacatggtggtggctttgaaggagctgtctatt
cggggtgactttcgaactacagttgaatacctgatcaaattgttagagactgaaagcttt
cagatgaacagaattgatactggctggctggacagactgatagcagaaaaagtacaggct
gagcgacctgacaccatgttgggggttgtgtgtggtgccctccacgtggcagatgtgagc
ctgcggaatagcgtctctaacttccttcactccttagaaaggggtcaagtccttcctgct
catacacttctgaatacagtagatgttgaacttatctatgagggagtcaagtatgtactt
aaggtgactcgacagtcccccaactcctatgtggtgatcatgaatggttcatgtgtagaa
gtagatgtacatcggctgagtgacggtggactgctcttgtcctatgatggcagcagttat
actacgtatatgaaagaggaagtggatagatatcgcatcacaattggcaataaaacctgt
gtgtttgagaaggaaaatgacccatcggtgatgcgctcaccttctgctgggaagttaatc
cagtacattgtagaagatggaggtcatgtgtttgctggccagtgctatgctgagattgag
gtgatgaagatggtaatgaccttaacagctgtggagtctggctgtatccattacgtcaag
cgacctggagcagctcttgaccctggctgtgtactagccaaaatgcaactggacaacccc
agcaaggttcagcaggctgaacttcacacaggtagtctgccacggatccagagcacggca
ctcagaggcgagaaactccatcgagtgttccattatgtcctggataatctggtcaatgta
atgaatggatactgccttccggatcctttctttagcagcaaggtaaaagactgggtagag
cgactgatgaaaaccctcagagatccctccctgcctctcctagaattgcaagatattatg
accagtgtgtctggccgcattccccccaatgtggagaagtctatcaagaaggaaatggct
cagtatgctagcaacatcacatcagtcctctgtcagtttcccagccagcagattgcaaac
atcctagatagccatgcagctacattgaaccggaaatctgaacgggaagtcttctttatg
aatactcagagcattgttcagctggtacagaggtaccgaagtggcatccgaggccacatg
aaggctgtggtgatggatctgctccggcagtacctgcgagtagagacacaattccagaat
ggtcactatgacaaatgtgtattcgccctccgggaagagaataaaagtgacatgaacact
gtactgaactacatcttctctcacgctcaagtcaccaagaagaatcttctggtcacaatg
cttattgatcagttgtgtggccgggaccctactctcactgatgagctgctgaatattctc
acagagctaactcaactcagtaagaccaccaatgccaaagtagcacttcgagcacgccag
gttcttattgcctcccatctgccatcatatgagcttcgccataaccaagtagagtctatc
ttcctatcagctattgacatgtatggacatcaattttgcattgagaacctgcagaaactc
atcctatcagaaacatctatttttgatgtcctaccaaacttcttctatcacagcaaccaa
gtagtgaggatggcagctctggaggtgtatgttcgaagggcttatattgcctacgaactt
aacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaattccagttcatg
ctgcccacatctcatccaaatagagggaacatccctacgctaaacagaatgtccttctcc
tccaacctcaaccactatggcatgacccatgtagctagtgtcagcgatgtactgttggac
aactcattcactccaccttgtcagcggatgggcggaatggtctcttttcggacttttgaa
gattttgtcaggatctttgatgaagtgatgggctgcttctctgactccccaccccagagt
cccacattccctgaggcaggtcacacgtctctttatgatgaagataaggttcccagggat
gaaccaattcacattctcaatgtggctatcaagactgactgtgatattgaggatgacagg
ctggcagctatgttcagagaatttacccagcaaaataaagctaccctggttgaccatggg
atccggcgccttactttcctggttgcacaaaaggatttcagaaagcaggtcaactatgag
gtggatcggagatttcatagagaattccctaaattttttacattccgagcaagggataag
tttgaggaggatcgtatctatcgtcatctggagcctgctctggctttccagttagagctg
aaccggatgagaaattttgacctcactgccattccatgcgctaatcacaagatgcacctg
tatctcggggcagccaaggtggaagtgggcacagaagtgacagactacaggttctttgtt
cgtgcaatcatcaggcattctgatctggtcaccaaggaagcttcttttgaatatctccaa
aatgaaggggagcggctactcctggaagccatggatgagttggaagttgcttttaacaat
acaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacggttatcatg
gacccatcaaagattgaggaatccgtgcggagcatggtaatgcggtatggaagtcgcctg
tggaaattgcgcgtcctccaggcagaactgaaaatcaacattcgcctgacgccaactgga
aaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttggatatcagc
ctatacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatatggagac
aaacagggaccactgcatggaatgttaatcaatactccatatgtgaccaaagacctgctg
caatcaaagaggttccaggcacagtccttagggacaacatacatatatgatatcccagag
atgtttcggcagtccctgatcaaactctgggagtctatgtccactcaagcatttcttcca
tctccccctctgccttctgacatgctgacttacactgaactggtattggatgatcaaggt
cagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagcttggaaa
atgacctttaaaagtcctgaatatccagaaggccgagatatcattgttattggcaatgac
atcacataccgaattgggtcctttgggcctcaagaggatttgttatttctcagagcttcc
gaacttgctagggcagaaggtattccacgcatctatgtatcagccaacagtggagcaaga
atcggactggcagaagaaattcgtcatatgtttcatgtggcctgggtagatcctgaggat
ccttacaagggatacaggtatttatatctgactcctcaagattataagagagtcagtgct
ctcaactctgtccattgtgaacacgtggaagatgaaggagaatccaggtacaagataaca
gatattattgggaaagaagagggaattggacccgagaaccttcgaggttctggaatgatt
gctggagaatcctcattggcctataatgagatcattaccatcagcctggtgacgtgccgg
gccattgggattggggcttaccttgtccggctgggacagagaaccatccaggttgagaat
tctcacttaattctaacaggagctggagccctcaataaagtcctcgggcgggaagtgtac
acctccaataaccagctggggggcatccagattatgcacaacaacggggtgacccactgc
actgtgtgtgatgactttgaaggggttttcactgtcctgcactggctgtcttacatgccc
aagagcgtgcacagttcagttcctcttctgaactcaaaggatcctatagacagaatcatc
gagtttgttcccacaaaggccccatacgatcctcgatggatgctagcaggccgtcctcac
ccaacccaaaaaggtcagtggttgagtggcttttttgactatggatctttctcagagatt
atgcagccctgggcacagactgtggtggttggtagagccaggctaggaggaatacctgtg
ggagttgttgctgtagaaacccgaacagtagaactaagtatcccagctgatccagcaaac
ctggattctgaagccaagataatccagcaggctggccaggtttggttcccagattctgcg
tttaagacgtatcaggccatcaaggacttcaaccgggaagggctgcctctgatggtcttt
gccaactggagaggcttctctggtggaatgaaagatatgtacgaccaagtgctgaagttt
ggtgcttacattgtggatggcttgagggagtgctgccagcctgtgctggtttacattcct
ccccaggctgagctgcggggtggctcctgggtggtgattgactcctccatcaacccccgg
cacatggagatgtatgctgaccgagaaagcaggggatctgttctggagccagaagggaca
gtagaaatcaaatttcgcagaaaggatctggtgaaaaccatgcgtcgggtggacccagtc
tacatccacttggctgagcgattggggaccccagagctaagcacagctgagcggaaggag
ttggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcaggtagcc
gtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgttattagc
gatatcctggattggaaaacatcccgtaccttcttctactggcgcctgaggcgtcttctg
ctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgactgatggccag
attcaagccatgttaaggcgctggtttgtggaagtggaaggaacagtgaaggcctatgtt
tgggacaataataaggatctggcggagtggctagagaaacagctgacagaggaggatggt
gttcactcggtaatagaggaaaacatcaaatgcatcagcagagactacgtcctcaagcag
atccgcagcttggtccaggccaatccagaggttgccatggattccatcatccatatgacc
cagcacatatcacccactcagcgagcagaagtcatacggatcctctccacaatggattcc
ccttccacgtag

DBGET integrated database retrieval system