KEGG   Pan paniscus (bonobo): 100985560Help
Entry
100985560         CDS       T02283                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
pps  Pan paniscus (bonobo)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100985560 (ENTPD2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     100985560 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 495 aa AA seqDB search
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALRDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLRDVYQSPCTMAQRPQTFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALV
LLLRQVHSAKLPSTI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggtgcggtcactgctgccgccgctgctgctggccgccgcgggcctcgcc
ggcctcctactgctgtgcgtccccacccgcgacgtccgggagccgcccgccctcaagtat
ggcatcgtcctggacgctggttcttcacacacgtccatgtttatctacaagtggccggca
gacaaggagaacgacacaggcattgtgggccagcacagctcctgtgatgttccaggtggg
ggcatctccagctatgcagacaacccttctggggccagccagagtcttgttggatgcctt
gaacaggcgcttcgggatgtgcccaaagagagacacgcaggcacacccctctacctggga
gccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctcgaccagtgtgctc
acggcagtgactcacacactgacccagtacccctttgacttccggggtgcacgcatcctc
tcgggccaggaagagggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtacggctgggtgggccggtggttccggccacggaaggggacactgggggccatg
gacctggggggtgcctctacccagatcacctttgagacaaccagtccagctgaggacaga
gccagcgaggtccagctgcatctctacggccagcactaccgagtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccagaggctgctggccagcgccctccagacccac
ggcttccacccctgctggccgaggggcttttccacccaagtgctgctcagggatgtgtac
cagtcaccatgcaccatggcccagcggccccagaccttcaacagcagtgctagggtcagc
ctgtcagggagcagtgacccccacctctgccgagatctggtttctgggctcttcagcttc
tcctcctgccccttctcccgatgctctttcaatggggtcttccagcccccagtggctggg
aactttgtggccttctctgccttcttctacactgtggactttttgcggacttcgatgggg
ctgcccgtggccaccctgcagcagctggaggcagccgcagtgaatgtctgcaaccagacc
tgggctcagctgcaagctcgggtgccagggcaacgggcccgcctggccgactactgcgcc
ggggccatgttcgtgcagcagctgctgagtcgcggctacggcttcgacgagcgcgccttc
ggcggcgtgatcttccagaagaaggccgcggacacggcagtgggctgggcgctcggctac
atgctgaacctgaccaacctgatccccgccgacccgccggggctgcgcaagggcacagac
ttcagctcctgggtcgtcctcctgctgctcttcgcctccgcgctcctggctgcgcttgtc
ctgctgctgcgtcaggtgcactccgccaagctgccaagcaccatttag

DBGET integrated database retrieval system