KEGG   Pan paniscus (bonobo): 100985634Help
Entry
100985634         CDS       T02283                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta 4, accessory subunit
  KO
K03505  DNA polymerase delta subunit 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps00240  Pyrimidine metabolism
pps01100  Metabolic pathways
pps03030  DNA replication
pps03410  Base excision repair
pps03420  Nucleotide excision repair
pps03430  Mismatch repair
pps03440  Homologous recombination
pps05166  HTLV-I infection
Module
pps_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100985634 (POLD4)
   00240 Pyrimidine metabolism
    100985634 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100985634 (POLD4)
   03410 Base excision repair
    100985634 (POLD4)
   03420 Nucleotide excision repair
    100985634 (POLD4)
   03430 Mismatch repair
    100985634 (POLD4)
   03440 Homologous recombination
    100985634 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100985634 (POLD4)
DNA replication proteins [BR:pps03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100985634 (POLD4)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100985634 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100985634 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100985634
NCBI-ProteinID: XP_003828767
Position
11
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
CTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgattcctacccggttgtgaagaggagggaggggccc
gctgggcacagcaagggggagctggcacccgagctaggggaggagccccagccccgcgac
gaggaggaagcggagctggaactgctgaggcagtttgacctggcctggcagtacgggccc
tgcaccgggatcacacggctgcagcgctggtgtcgggccaagcagatgggcttggagcct
cccccagaggtgtggcaggtgctgaagacccaccccggagacccccgcttccagtgcagt
ctctggcatctctatcccctatga

DBGET integrated database retrieval system