KEGG   Pan paniscus (bonobo): 100985639Help
Entry
100985639         CDS       T02283                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 544 aa AA seqDB search
MVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLS
SPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEK
IPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLP
RTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCSLEPSTRAPFTEITQHLEWILEQLPEPA
PLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFS
LREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSP
ELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSA
SQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREP
DEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHTKPPTPSLQLP
GARS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaagatgaacaagctccccagtaaccggggcaacacactacgggaagtgcag
ctgatgaaccggctcaggcaccccaacatcctaaggttcatgggggtctgtgtgcaccag
ggacagctgcacgctcttacagagtatatgaatggggggacattggaacagctgctcagc
tcccctgaacccctatcctggccggtcaggctccacctggccctggacattgcccgaggc
ctgcggtacctgcactccaaaggtgtatttcaccgcgacctcacatccaagaactgtcta
gtccgacgggaagatcgaggcttcaccgctgtcgtgggtgacttcgggctggccgaaaag
attcctgtgtatagggagggggcaaggaaggagccattggctgtggtgggctccccatac
tggatggctccagaggtgttacggggtgagctgtatgatgagaaggctgatgtctttgcc
ttcgggattgtcctctgtgagctcatcgcccgagtacctgcagaccctgactacctacca
cgcactgaggactttggcctggatgtgcctgctttccgaactctggtgggggatgactgc
ccactgcctttcttgctcctggccatccactgctgcagcctggaacccagcacccgtgcc
cccttcactgaaattacccagcacctggaatggatcctggagcagctgcctgagccagcc
ccactcaccaggaccgccctgacacacaatcagggctctgttgcaagagggggtccctct
gccacgcttcccaggccagatccccggctttcccgaagccggtcagacctcttcctgccc
ccatcaccagaatcaccccccaactggggggacaatctgactcgagtcaaccccttctca
ctacgggaagacctcaggggtggcaagatcaagctcttggacacgcccagcaagccagtc
ctgcctcttgtgccaccatcaccattcccatccactcagctgcccttggtgaccacccca
gagaccctggtccagcctgggacacctgcccgccgctgccgctcactaccctcatccccc
gagctcccccgccgtatggagacagcactgccaggtcctggccctcccgccgtgggcccc
tcggctgaagagaagatggagtgcgagggcagcagccctgagccggaacctccaggacca
gcgccccagctgcctctggctgtggccacagacaacttcatcagcacctgttcctcggcc
tcccaaccctggtcccctagatcaggacccgtcctcaataacaatcccccagctgtggtg
gtgaactccccacaaggctgggctggggagccctggaaccgggcccagcatagcctgccc
cgggcggcagccctggagcggacagaaccctcgccacccccttcagctccccgggagccc
gatgaggggctgccctgtcctggctgctgcctcggccccttcagctttggcttcctgtcc
atgtgcccccgccccacaccagctgttgcccgctaccgcaacctgaactgtgaggcgggc
agtctcctctgccaccgagggcaccacaccaagccacccacacccagcctgcagctgcct
ggggcacgctcttag

DBGET integrated database retrieval system