KEGG   Pan paniscus (bonobo): 100985734Help
Entry
100985734         CDS       T02283                                 

Definition
(RefSeq) glutathione S-transferase A1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100985734
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100985734
   00982 Drug metabolism - cytochrome P450
    100985734
   00983 Drug metabolism - other enzymes
    100985734
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100985734
   05204 Chemical carcinogenesis
    100985734
   05225 Hepatocellular carcinoma
    100985734
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100985734
  Drug resistance
   01524 Platinum drug resistance
    100985734
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100985734
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100985734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 222 aa AA seqDB search
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGMADLGEMILLLPVCPPEEKDAK
LALIKEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacccaagctccactacttcaatgcacggggcagaatggagtccacccgg
tggctcctggctgcagctggagtagagtttgaagagaagtttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagagagccctgattgatatgtatatagaaggtatggca
gatttgggtgaaatgatcctccttctgcccgtatgtccacctgaggaaaaagatgccaag
cttgctttgatcaaagagaaaacaaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattcatctg
gtggaacttctctactacgtggaagagcttgactccagtctcatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacttgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

DBGET integrated database retrieval system