KEGG   Pan paniscus (bonobo): 100985836Help
Entry
100985836         CDS       T02283                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100985836 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100985836 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100985836 (PFN2)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100985836 (PFN2)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100985836 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 124 aa AA seqDB search
MVRGNLFKKRSRRSLEKKKRKSSFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD
SLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLR
RSDV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtaaggggaaatttgttcaagaagagatcccgcaggagtttggaaaaaaaaaagagg
aaatcaagctttcagagcattacgccaatagaaatagatatgattgtaggaaaagaccgg
gaaggtttctttaccaacggtttgactcttggcgcgaagaagtgctcagtgatcagagat
agtctatacgtcgatggtgactgcacaatggacatccggacaaagagtcaaggtggggag
ccaacatacaatgtggctgtcggcagagctggtagagcattggttatagtcatgggaaag
gaaggtgtccacggaggcacacttaacaagaaagcatatgaactcgctttatacctgagg
aggtctgatgtgtaa

DBGET integrated database retrieval system