KEGG   Pan paniscus (bonobo): 100985968Help
Entry
100985968         CDS       T02283                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100985968 (EIF3J)
Translation factors [BR:pps03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100985968 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 207 aa AA seqDB search
MCGPKTGSVASRTPSPVESLLSGVDPTRRLATKGDSIGRVGPRASFALEEPEEPKVLTPE
EQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYE
KSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGG
LKATMKDDLADYGGYDGGYVQDYEDFM
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggccgaagactggcagcgtggcctcccggactccctcgccggttgagagtctg
ctctccggcgtggatcccacccgccggctggcgacgaaaggtgacagcatcggccgggtc
ggcccacgtgcaagcttcgcgttagaagaacctgaagaacctaaagtgctaacaccagaa
gaacaattagcagataaactgcggctaaagaaattacaggaagagtcagacctcgaatta
gcaaaggaaacttttggtgttaataatacagtttatggaatagatgctatgaacccatct
tcaagagatgactttacagagtttggaaagttactaaaagataaaattacacaatatgaa
aagtcactatattatgccagttttttggaagtcttagttcgagatgtgtgtatttcattg
gaaattgatgacttgaaaaaaattaccaattcactgactgtgctttgcagtgaaaaacag
aagcaagaaaagcaaagcaaagccaaaaagaagaagaaaggtgtggttcctggaggggga
ttaaaagccaccatgaaagatgatctggcagattatggtggttatgatggaggatatgta
caagactatgaagacttcatgtga

DBGET integrated database retrieval system