KEGG   Pan paniscus (bonobo): 100986382Help
Entry
100986382         CDS       T02283                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pps00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 231 aa AA seqDB search
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccactgtgtctggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcgcct
aggatccctgtgaccctcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggacgaggctggcatcaagaaggcagcagagaacatcaag
gccttgattgagcatgaaatgaagaacgggatccctgccaatcgaatcgtcctgggaggc
ttttcacagggcggggccctgtccctctacacggccctcacctgcccccaccctctggct
ggcatcgtggcgttgagctgctggctgcctctgcaccgggccttcccccaggcagctaat
ggcagtgccaaggacctggccatactccagtgccatggggagctggaccccatggtgccc
gtacggtttggggccctgacggctgagaagctccggtctgttgtcacacctgccagggtc
cagttcaagacatacccgggtgtcatgcacagctcctgtcctcaggagatggcagctgtg
aaggaatttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system