KEGG   Pan paniscus (bonobo): 100986446Help
Entry
100986446         CDS       T02283                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:pps04622]
Organismal Systems; Development; Osteoclast differentiation [PATH:pps04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 953 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNGSSV
DSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLPFSL
TKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKD
LPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagtcacttcaccctactgggaagagcggatt
ttttacttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgtagagataaatgaaaagttcacagagttactt
ttggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgtcctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacccctcttagcagagaggacagtctccgga
atattctttggagttgaattgctggaagaaggtcgtggtcaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagattgtggcgtgtttgttgcattggac
aagctagaactcatagaagatgatgacactgcattggaaagtgattacgcaggtcctggg
gacacaatgcaggtcgaacttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattc
gatggagtgcagctttgtagttttgcatgtgttgaaagtacaattctattgcacatcaat
gatatcatcccagagagtgtgacacaggaaaggaggcctcccaaacttgcctttatgtca
agaggtgttggggacaaaggttcatccagtcataataaaccaaaggctacaggatctacc
tcagaccctggaaatagaaacagatctgaattattttataccttaaatgggtcttctgtt
gactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagttgcagaagac
cctgcaaaatctcttacagagatatctacagactttgaccgttcttcaccaccactccag
cctcctcctgtgaactcactgaccaccgagaacagattccactctttaccattcagtctc
accaagatgcccaataccaatggaagtattggccacagtccactttctctgtcagcccag
tctgtaatggaagagctaaacactgcacccgtccaagagagtccacccttggccatgcct
cctgggaactcacatggtctagaagtgggctcattggctgaagttaaggagaaccctcct
ttctatggggtaatccgttggatcggtcagccaccaggactgaatgaagtgctcgctgga
ctggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggcactcggtat
ttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcaggcctgactct
aggtttgcatcattgcagccggtttccaatcagatcgagcgctgtaactctttagcattt
ggaggctacttaagtgaagtagtagaagaaaatactccaccaaaaatggaaaaagaaggc
ttggagataatgattgggaagaagaaaggcatccagggtcattacaattcttgttactta
gactcaaccttattctgcttatttgcttttagttctgttctggacactgtgttacttaga
cccaaagaaaagaacgatgtagaatattatagtgaaacccaagagctactgaggacagaa
attgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatgaaactgagg
aaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaagatcctgag
gaattcttgaatattctgtttcatcatattttaagggtagaacctttgctaaaaataaga
tcagcaggtcaaaaggtacaagattgttacttctatcaaatttttatggaaaaaaatgag
aaagttggcgttcccacaattcagcagttgttagaatggtcttttatcaacagtaacctg
aaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttggaaaagacttt
aaactatttaaaaaaatttttccttctctggaattaaatataacagatttacttgaagac
actcccagacagtgccggatatgtggagggcttgcaatgtatgagtgtagagaatgctac
gacgatccggacatctcagctggaaaaatcaagcagttttgtaaaacctgcaacactcaa
gtccaccttcatccgaagaggctgaatcataaatataacccagtgtcacttcccaaagac
ttacctgactgggactggagacacggctgcatcccttgccagaatatggagttatttgct
gttctctgcatagaaacaagccactatgttgctttcgtgaagtatgggaaggacgattcc
gcctggctcttctttgacagcatggccgatcgggatggtggtcagaacggcttcaacatt
cctcaagtcaccccatgcccagaagtaggagagtacttgaagatgtctctggaagacctg
cattccttggactccaggagaatccaaggctgtgcacgaagactgctttgtgatgcatat
atgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system