KEGG   Pan paniscus (bonobo): 100986556Help
Entry
100986556         CDS       T02283                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 915 aa AA seqDB search
MENNTKQNKNKGLAIKPLLICAQRQTARGGARGPGGGAQGVAGKRRRTWVRAYVLAHGGG
GGAERPEPETELGSGPGRGGASGAKQILGAGTEPGRAGLKRSPGTGREVPGVPGLGGGAA
LVAAGCRDSGRSVAAITDFLWDKRTGLAARTMPHPRRYHSSERGSRGSYREHYRSRKHKR
RRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDRRVYDRRYCGSYRRNDYSRDRGDA
YYDTDYRHSYEYQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSQHSSRRAKSVEDDAEG
HLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEI
NVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRH
MAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFG
SATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREH
LAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRDPAVIQHRPS
RQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASA
AAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDI
SMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFTPC
SFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGN
TAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAA
ANAAAGAAENAFRAP
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaacacaaaacaaaacaaaaacaaaggcctagccataaagccactgctcatc
tgtgcccaacgacagacagcacgtggtggcgcgcgcggtcctgggggcggagcccagggg
gtagctgggaagcgacgcaggacgtgggtccgtgcgtacgtgctcgctcacggcggcggc
ggcggagcggagaggccagagccggagaccgagctgggatcgggccccgggcggggcggt
gcgagcggcgccaagcagatcttaggggcggggacggagccggggcgggcgggactgaag
cggagcccgggaacggggcgggaggtcccaggggttcccgggttggggggtggagcagca
cttgtcgccgcggggtgccgggactccggccgcagtgtcgccgccatcacggacttcctg
tgggacaagcgcacgggcctcgccgccagaacgatgcctcatcctcgaaggtaccactcc
tcagagcgaggcagccgggggagttaccgtgaacactatcggagccgaaagcataagcga
cgaagaagtcgctcctggtcaagtagtagtgaccggacacgacggcgtcggcgagaggac
agctaccatgtccgttctcgaagcagttatgatgatcgttcgtccgaccggagggtgtat
gaccggcgatactgtggcagctacagacgcaacgattatagccgggatcggggagatgcc
tactatgacacagactatcggcattcctatgaatatcagcgggagaacagcagttaccgc
agccagcgcagcagccggaggaagcacagacggcggaggaggcgcagccggacatttagc
cgctcatcttcgcagcacagcagccggagagccaagagtgtagaggacgacgctgagggc
cacctcatctaccacgtcggggactggctacaagagcgatatgaaatcgttagcacctta
ggagaggggaccttcggccgagttgtacaatgtgttgaccatcgcaggggtggggctcga
gttgccctgaagatcattaagaatgtggagaagtacaaggaagcagctcgacttgagatc
aacgtgctagagaaaatcaatgagaaagaccctgacaacaagaacctctgtgtccagatg
tttgactggtttgactaccatggccacatgtgtatctcctttgagcttctgggccttagc
accttcgatttcctcaaagacaacaactacctgccctaccccatccaccaagtgcgccac
atggccttccagctgtgccaggctgtcaagttcctccatgataacaagctgacacataca
gacctcaagcctgaaaatattctgtttgtgaattcagactatgagctcacctacaaccta
gagaagaagcgagatgagcgcagtgtgaagagcacagctgtgcgggtggtagactttggc
agtgccacctttgaccatgagcaccatagcaccattgtctccactcgccattaccgagca
ccagaagtcatccttgagttgggctggtcacagccttgtgatgtgtggagtataggctgc
atcatctttgaatactatgtgggattcaccctcttccagacccatgacaacagagagcat
ctagccatgatggaaaggatcttgggtcctatcccttcccggatgatccgaaagacaaga
aagcagaaatatttttaccggggtcgcctggattgggatgagaacacatcagctgggcgc
tatgttcgtgagaactgcaaaccgctgcgggacccagctgtgatccagcaccgacccagc
cggcagtatgccacgcttgacgtctacaacccttttgagacccgggagccaccaccagcc
tatgagcctccagcccctgccccattgcctccaccctcagctccctccttgcagccctcg
agaaagctcagccccacagaacctaagaactatggctcatacagcactcaggcctcagct
gcagcagccacagctgagctgctgaagaaacaggaggagctcaaccggaaggcagaggag
ttggaccgaagggagcgagagctgcagcatgctgccctggggggcacagctactcgacag
aacaattggccccctctaccttctttttgtccagttcagccctgctttttccaggacatc
tccatggagatcccccaagaatttcagaagactgtatccaccatgtactacctctggatg
tgcagcacgctggctcttctcctgaacttcctcgcctgcctggccagcttctgtgtggaa
accaacaatggcgcaggctttgggctttctatcctctgggtcctccttttcactccctgc
tcctttgtctgctggtaccgccccatgtataaggctttccggagtgacagttcattcaat
ttcttcgttttcttcttcattttcttcgtccaggatgtgctctttgtcctccaggccatt
ggtatcccaggttggggattcagtggctggatctccgctctggtggtgccgaagggcaac
acagcagtatccgtgctcatgctgctggtcgccctgctcttcactggcattgctgtgcta
ggaattgtcatgctgaaacggatccactccttataccgccgcacaggtgccagctttcag
aaggcccagcaagaatttgctgctggtgtcttctccaaccctgcggtgcgaaccgcagct
gccaatgcagccgctggggctgctgaaaatgccttccgggccccgtga

DBGET integrated database retrieval system