KEGG   Pan paniscus (bonobo): 100986556Help
Entry
100986556         CDS       T02283                                 

Gene name
CLK2
Definition
(RefSeq) CDC-like kinase 2
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100986556 (CLK2)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100986556 (CLK2)
Spliceosome [BR:pps03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100986556 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 499 aa AA seqDB search
MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQC
VDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMC
ISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQ
PCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFA
RLRAEPPNKLWDSSRDISR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatcctcgaaggtaccactcctcagagcgaggcagccgggggagttaccgtgaa
cactatcggagccgaaagcataagcgacgaagaagtcgctcctggtcaagtagtagtgac
cggacacgacggcgtcggcgagaggacagctaccatgtccgttctcgaagcagttatgat
gatcgttcgtccgaccggagggtgtatgaccggcgatactgtggcagctacagacgcaac
gattatagccgggatcggggagatgcctactatgacacagactatcggcattcctatgaa
tatcagcgggagaacagcagttaccgcagccagcgcagcagccggaggaagcacagacgg
cggaggaggcgcagccggacatttagccgctcatcttcgcagcacagcagccggagagcc
aagagtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaa
gagcgatatgaaatcgttagcaccttaggagaggggaccttcggccgagttgtacaatgt
gttgaccatcgcaggggtggggctcgagttgccctgaagatcattaagaatgtggagaag
tacaaggaagcagctcgacttgagatcaacgtgctagagaaaatcaatgagaaagaccct
gacaacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgt
atctcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctg
ccctaccccatccaccaagtgcgccacatggccttccagctgtgccaggctgtcaagttc
ctccatgataacaagctgacacatacagacctcaagcctgaaaatattctgtttgtgaat
tcagactatgagctcacctacaacctagagaagaagcgagatgagcgcagtgtgaagagc
acagctgtgcgggtggtagactttggcagtgccacctttgaccatgagcaccatagcacc
attgtctccactcgccattaccgagcaccagaagtcatccttgagttgggctggtcacag
ccttgtgatgtgtggagtataggctgcatcatctttgaatactatgtgggattcaccctc
ttccagacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcctatc
ccttcccggatgatccgaaagacaagaaagcagaaatatttttaccggggtcgcctggat
tgggatgagaacacatcagctgggcgctatgttcgtgagaactgcaaaccgctgcggcgg
tatctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgcta
gagtatgaaccagctaagcggctgaccttgggtgaagcccttcagcatcctttcttcgcc
cgccttcgggctgagccgcccaacaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system