KEGG   Pan paniscus (bonobo): 100986808Help
Entry
100986808         CDS       T02283                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04152  AMPK signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100986808 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    100986808 (ADRA1A)
   04152 AMPK signaling pathway
    100986808 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986808 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100986808 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100986808 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    100986808 (ADRA1A)
G protein-coupled receptors [BR:pps04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100986808 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100986808
NCBI-ProteinID: XP_003823597
Position
8
AA seq 429 aa AA seqDB search
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARGHTPMT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcttccgacagctccaactgcacccaaccgccggcaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcattcttttcggg
gtgctgggtaacatcctagtgatcctctccgtagcctgtcaccgacacctgcactcagtc
acgcactactacatcgtcaacctggcggtggccgacctcctgctcacctccacggtgctg
cccttttccgccatcttcgaggtcctaggctactgggccttcggcagggtcttctgcaac
atctgggcggcagtggatgtgctgtgctgcaccgcgtccatcatgggcctctgcatcatc
tccatcgaccgctacatcggcgtgagctacccgctgcgctacccaaccatcgtcacccag
aggaggggtctcatggctttgctctgcgtctgggcactctccctggtcatatccattgga
cccctgttcggctggaggcagccggcccccgaggacgagaccatctgccagatcaacgag
gagccgggctacgtgctcttctcagcgctgggctccttctacctgccgctggccatcatc
ctggtcatgtactgccgcgtctacgtggtggccaagagggagagccggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaagtgacgctccgcatccatcggaaaaac
gccccggcaggaggcagcgggatggccagcgccaagaccaagacgcacttctcagtgagg
ctcctcaagttctcccgggagaagaaagcggccaaaacgctgggcatcgtggttggctgc
ttcgtcctctgctggctgcctttcttcttagtcatgcccattgggtctttcttccctgat
ttcaagccctctgaaacagtttttaaaatagtattttggctcggatatctaaacagctgc
atcaaccccatcatatacccatgctccagccaagagttcaaaaaggcctttcagaatgtc
ttgagaatccagtgtctccgcagaaagcagtcttccaaacatgccctgggctacaccctg
cacccgcccagccaggccgtggaagggcagcacaaggacatggtgcgcatccccgtggga
tcaagagagaccttctacaggatctccaagacggatggcgtttgtgaatggaaatttttc
tcttccatgccccgtggatctgccaggattacagtgtccaaagaccaatcctcctgtacc
acagcccggggacacacacccatgacatga

DBGET integrated database retrieval system