KEGG   Pan paniscus (bonobo): 100986882Help
Entry
100986882         CDS       T02283                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pps  Pan paniscus (bonobo)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pps00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pps00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:pps04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 566 aa AA seqDB search
MSDRLFSKRGPAPTPQGCFSRGCGWSGCILPSPSYRAGPQFPVPPTRLCRLRWDFVLPPV
GAAVSLRRRDSGTPAVFSSSSDPEVMEFSSPSREECPKPSGRVSIMAGSLTGLLLLQAVS
WASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGTI
QANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGY
NIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLA
SPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEP
SAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVL
TDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGS
WDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPM
FYHLGHFSKFIPEGSQRVGLVASQKN
NT seq 1699 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgtctcttttccaagcgaggccccgccccgactccccagggctgcttttct
cgcggctgcgggtggtcgggctgcatcctgccttcaccgtcttaccgcgcggggccccag
ttcccagtcccgcccacgcgcctttgcaggctgcggtgggatttcgttttgcctccggtt
ggggctgctgtttctcttcgccgacgagactctggaacccctgcggtcttctcctcatct
agtgaccctgaggtgatggagttttcaagtccttccagagaggaatgtcccaagccttcg
ggtagggtaagcatcatggctggcagcctcacaggattgcttctacttcaggcagtgtcg
tgggcatcaggtgcccgcccctgcatccctaaaagcttcggctacagctcggtggtctgt
gtctgcaatgccacatactgtgactcctttgaccccccgacctttcctgcccttggtacc
ttcagccgctatgagagtacacgcagtgggcgacggatggagctgagtatggggaccatc
caggctaatcacacgggcacaggcctgctactgaccctgcagccagaacagaagttccag
aaagtgaagggatttggaggggccatgacagacgctgctgctctcaacatccttgccctg
tcaccccctgcccaaaatttgctacttaaatcgtacttctctgaagaaggaatcggatat
aacatcatccgggtacccatggccagctgtgacttctccatccgcacctacacctatgca
gacacccctgatgatttccagttgcacaacttcagcctcccagaggaagataccaagctc
aagatacccctgattcaccgagccctgcagttggcccagcgtcccgtttcactccttgcc
agcccctggacatcacccacttggctaaagaccaatggagcggtgaatgggaaggggtca
ctcaagggacagcccggagacatctaccaccagacctgggccagatactttgtgaagttc
ctggatgcctatgctgagcacaagttacagttctgggcagtgacagctgaaaatgagcct
tctgctgggctgttgagtggataccccttccagtgcctgggcttcacccctgaacatcag
cgagacttcattgcccgtgacctaggtcctaccctcgccaacagtactcaccacaatgtc
cgcctactcatgctggatgaccaacgcttgctgctgccccactgggcaaaggtggtactg
acagacccagaagcagctaaatatgttcatggcattgctgtacattggtacctggacttt
ctggctccagccaaagccaccctaggggagacacaccgcctgttccccaacaccatgctc
tttgcctcagaggcctgtgtgggctccaagttctgggagcagagtgtgcggctaggctcc
tgggatcgagggatgcagtacagccacagcatcatcacaaacctcctgtaccatgtggtc
ggctggaccgactggaaccttgccctgaaccccgaaggaggacccaattgggtgcgtaac
tttgttgacagtcccatcattgtagacatcaccaaggacacgttttacaaacagcccatg
ttctaccaccttggccacttcagcaagttcattcctgagggctcccagagagtggggctg
gttgccagtcagaagaacg

DBGET integrated database retrieval system