KEGG   Pan paniscus (bonobo): 100986882Help
Entry
100986882         CDS       T02283                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pps  Pan paniscus (bonobo)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100986882
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100986882
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100986882
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100986882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 566 aa AA seqDB search
MSDRLFSKRGPAPTPQGCFSRGCGWSGCILPSPSYRAGPQFPVPPTRLCRLRWDFVLPPV
GAAVSLRRRDSGTPAVFSSSSDPEVMEFSSPSREECPKPSGRVSIMAGSLTGLLLLQAVS
WASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGTI
QANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGY
NIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLA
SPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEP
SAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVL
TDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGS
WDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPM
FYHLGHFSKFIPEGSQRVGLVASQKN
NT seq 1699 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgtctcttttccaagcgaggccccgccccgactccccagggctgcttttct
cgcggctgcgggtggtcgggctgcatcctgccttcaccgtcttaccgcgcggggccccag
ttcccagtcccgcccacgcgcctttgcaggctgcggtgggatttcgttttgcctccggtt
ggggctgctgtttctcttcgccgacgagactctggaacccctgcggtcttctcctcatct
agtgaccctgaggtgatggagttttcaagtccttccagagaggaatgtcccaagccttcg
ggtagggtaagcatcatggctggcagcctcacaggattgcttctacttcaggcagtgtcg
tgggcatcaggtgcccgcccctgcatccctaaaagcttcggctacagctcggtggtctgt
gtctgcaatgccacatactgtgactcctttgaccccccgacctttcctgcccttggtacc
ttcagccgctatgagagtacacgcagtgggcgacggatggagctgagtatggggaccatc
caggctaatcacacgggcacaggcctgctactgaccctgcagccagaacagaagttccag
aaagtgaagggatttggaggggccatgacagacgctgctgctctcaacatccttgccctg
tcaccccctgcccaaaatttgctacttaaatcgtacttctctgaagaaggaatcggatat
aacatcatccgggtacccatggccagctgtgacttctccatccgcacctacacctatgca
gacacccctgatgatttccagttgcacaacttcagcctcccagaggaagataccaagctc
aagatacccctgattcaccgagccctgcagttggcccagcgtcccgtttcactccttgcc
agcccctggacatcacccacttggctaaagaccaatggagcggtgaatgggaaggggtca
ctcaagggacagcccggagacatctaccaccagacctgggccagatactttgtgaagttc
ctggatgcctatgctgagcacaagttacagttctgggcagtgacagctgaaaatgagcct
tctgctgggctgttgagtggataccccttccagtgcctgggcttcacccctgaacatcag
cgagacttcattgcccgtgacctaggtcctaccctcgccaacagtactcaccacaatgtc
cgcctactcatgctggatgaccaacgcttgctgctgccccactgggcaaaggtggtactg
acagacccagaagcagctaaatatgttcatggcattgctgtacattggtacctggacttt
ctggctccagccaaagccaccctaggggagacacaccgcctgttccccaacaccatgctc
tttgcctcagaggcctgtgtgggctccaagttctgggagcagagtgtgcggctaggctcc
tgggatcgagggatgcagtacagccacagcatcatcacaaacctcctgtaccatgtggtc
ggctggaccgactggaaccttgccctgaaccccgaaggaggacccaattgggtgcgtaac
tttgttgacagtcccatcattgtagacatcaccaaggacacgttttacaaacagcccatg
ttctaccaccttggccacttcagcaagttcattcctgagggctcccagagagtggggctg
gttgccagtcagaagaacg

DBGET integrated database retrieval system