KEGG   Pan paniscus (bonobo): 100987273Help
Entry
100987273         CDS       T02283                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 712 aa AA seqDB search
MLAMDKCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYHCTTRSGRFL
RSAGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRRQELEYQVKAELESMPPRKSLRLQGLTQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVRSRQSSLSSGLSGGA
SKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQC
NSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPNEDADTSSNEILS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaatggataagtgcaaacatgttgggcagctgcagcttgctcaagaccattcc
agcctcaaccctcagaaatggcactgtgtggactgcaacacgaccgagtccatttgggct
tgccttagctgctcccatgttgcctgtggaagatatattgaagagcatgcactcaagcac
tttcaagaaagcagtcatcctgttgcattggaggtgaatgagatgtacgttttttgttac
ctttgtgatgattatgttctgaatgataatgcaactggagacctgaagttactacgaagt
acattaagtgccatcaaaagtcaaaattatcactgcacaactcgtagtgggaggttttta
cggtccgcaggtacaggtgatgattcttatttcttacatgacggtgcccaatctctgctt
caaagtgaagatcaactgtatactgctctttggcacaggagaaggatactaatgggtaaa
atctttcgaacatggtttgaacaatcacccattggaagaaaaaagcaagaagaaccattt
caggaaaaaatagtagtaaaaagagaagtaaagaaaagacggcaggaattggagtatcaa
gttaaagcagaattggaaagtatgcctccaagaaagagtttacgtttacaagggctcact
cagtcgaccataatagaaatagtttctgttcaggtgccagcacaaacgccagcatcacca
gcaaaagataaagtactctctacctcagaaaatgaaatatctcaaaaagtcagtgactcc
tcagttaaacgaaggccaatagtaactcctggtgtaacaggattgagaaatttgggaaat
acttgctatatgaattctgttcttcaggtgttgagtcatttacttatttttcgacaatgt
tttttaaagcttgatctgaaccaatggctggctatgactgctagtgagaagacaagatct
tgtaagcatccaccagtcacagatacagtagtatatcaaatgaatgaatgtcaggaaaaa
gatacaggttttgttcgctccagacaatcaagtctgtcatcaggactaagtggtggagca
tcaaaaggtagaaagatggaacttattcagccaaaggagccaacttcacagtacatttct
ctttgtcatgaattgcatactttgttccaagtcatgtggtctggaaagtgggcgttggtc
tcaccatttgctatgctacactcagtgtggagactcattcctgcctttcgtggttacgcc
caacaagacgctcaggaatttctttgtgaacttttagataaaatacaacgtgaattagag
acaactggtaccagtttaccagctcttatccccacttctcaaaggaaactcatcaaacaa
gttctgaatgttgtaaataacatttttcatggacaacttcttagtcaggttacatgtctt
gcatgtgacaacaaatcaaataccatagaacctttctgggacttgtcattggagtttcca
gaaaggtatcaatgcagtggaaaagatattgcttcccagccatgtctggttactgaaatg
ttggccaaatttacagaaactgaagctttagaaggaaaaatctacgtatgtgaccagtgt
aactcaaagcgtagaaggttttcctccaaaccagttgtactcacagaagcccagaaacaa
cttatgatatgccacctacctcaggttctcagactgcacctcaaacgattcaggtggtca
ggacgtaataaccgagagaagattggtgttcatgttggctttgaggaaatcttaaacatg
gagccctattgctgcagggagaccctgaaatccctcagaccagaatgctttatctatgac
ttgtccgcggtggtgatgcaccatgggaaaggatttggctcagggcactacactgcctac
tgctataattctgaaggagggttctgggtacactgcaatgattccaaactaagcatgtgc
actatggatgaagtatgcaaggctcaagcttatatcttgttttatacccaacgagttact
gagaatggacattctaaacttttgcctccagagctcctgttggggagccagcatcccaat
gaagacgctgatacctcgtctaatgaaatccttagctga

DBGET integrated database retrieval system