KEGG   Pan paniscus (bonobo): 100987524Help
Entry
100987524         CDS       T02283                                 

Gene name
PLCB3
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100987524 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100987524 (PLCB3)
   04310 Wnt signaling pathway
    100987524 (PLCB3)
   04020 Calcium signaling pathway
    100987524 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100987524 (PLCB3)
   04022 cGMP - PKG signaling pathway
    100987524 (PLCB3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100987524 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100987524 (PLCB3)
   04062 Chemokine signaling pathway
    100987524 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    100987524 (PLCB3)
   04912 GnRH signaling pathway
    100987524 (PLCB3)
   04915 Estrogen signaling pathway
    100987524 (PLCB3)
   04921 Oxytocin signaling pathway
    100987524 (PLCB3)
   04918 Thyroid hormone synthesis
    100987524 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100987524 (PLCB3)
   04916 Melanogenesis
    100987524 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100987524 (PLCB3)
   04270 Vascular smooth muscle contraction
    100987524 (PLCB3)
  Digestive system
   04970 Salivary secretion
    100987524 (PLCB3)
   04971 Gastric acid secretion
    100987524 (PLCB3)
   04972 Pancreatic secretion
    100987524 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100987524 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    100987524 (PLCB3)
   04725 Cholinergic synapse
    100987524 (PLCB3)
   04728 Dopaminergic synapse
    100987524 (PLCB3)
   04726 Serotonergic synapse
    100987524 (PLCB3)
   04720 Long-term potentiation
    100987524 (PLCB3)
   04730 Long-term depression
    100987524 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100987524 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100987524 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    100987524 (PLCB3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100987524 (PLCB3)
   05016 Huntington's disease
    100987524 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    100987524 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    100987524 (PLCB3)
   05143 African trypanosomiasis
    100987524 (PLCB3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100987524 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1234 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
TGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDVRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaaactg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcgattcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgtgacccgagactcaac
gaagtgctgtacccacccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctatggggctgccgctgc
gtggagctggacgtgtggaagggacggccacccgaggaggaacccttcattacccacggc
ttcaccatgaccacggaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacgtcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
actgggcgcaagcggcccctggagcagagcaattctgccctgagcgagagctccgcggcc
accgagccctcctccccgcagttggggtctcccagctctgacagctgcccaggcctgagc
aatggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggcgac
gagggcctgaaccggggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttt
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagacccttgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacactgaagcctcggactacattcctgacgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccctagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctaccagcacctccctcagcagcccagggcagcgcgatgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccggagccggcaagagcgagacgtgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcacgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

DBGET integrated database retrieval system