KEGG   Pan paniscus (bonobo): 100987532Help
Entry
100987532         CDS       T02283                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pps00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 524 aa AA seqDB search
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALKLQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILHWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRHKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYI
PHVMAYAACIGANLDHCAPASSAGSLAAGPLLLALALFPLSVLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccattcttagtactggccattggcacctgccttaccaactccttagtgcca
gagaaagagaaagaccccaagtactggcgagaccaagcgcaagagaccctgaaatacgcc
ctgaagcttcagaagctcaacaccaacgtggctaagaatgtcatcatgttcctgggagat
gggatgggcgtctccacagtgacggctgcccgcatcctcaagggtcagctccaccacaac
cctggggaggagaccaggctggagatggacaagttccccttcgtggccctctccaagacg
tacaacaccaatgcccaggtccctgacagcgccggcaccgccaccgcctacctgtgtggg
gtgaaggccaatgagggcaccgtgggggtaagcgcagccactgagcgttcccggtgcaac
accacccaggggaacgaggtcacctccatcctgcactgggccaaggacgctgggaaatct
gtgggcattgtgaccaccacgagagtgaaccatgccacccccagcgccgcctacgcccac
tcggctgaccgggactggtactcagacaacgagatgccccctgaggccttgagccagggc
tgcaaggacatcgcctaccagctcatgcataatatcagggacattgacgtgatcatgggg
ggtggccggaaatacatgtaccccaagaataaaactgatgtggagtatgagagtgacgag
aaagccaggggcacgaggctggacggcctggacctcgttgacacctggaagagcttcaaa
ccgagacacaagcactcccacttcatctggaaccgcacggaactcctgacccttgacccc
cacaatgtggactacctattgggtctcttcgagccaggggacatgcagtacgaactgaac
aggaacaacgtgacggacccgtcactctccgagatggtggtggtggccatccagatcctg
cggaagaaccccaaaggcttcttcttgctggtggaaggaggcagaattgaccacgggcac
catgaaggaaaagccaagcaggccctgcatgaggcggtggagatggaccgggccatcggg
caggcaggcagcctgacctcctcggaagacactctgaccgtggtcactgcggaccattcc
cacgtcttcacatttggtggatacaccccccgtggcaactctatctttggtctggccccc
atgctgagtgacacagacaagaagcccttcactgccatcctgtatggcaatgggcctggc
tacaaggtggtgggcggtgaacgagagaatgtctccatggtggactatgctcacaacaac
taccaggcgcagtctgctgtgcccctgcgccacgagacccacggcggggaggacgtggcc
gtcttctccaagggccccatggcgcacctgctgcatggcgtccacgagcagaactacatc
ccccacgtgatggcgtatgcagcctgcattggggccaacctcgaccactgtgctcctgcc
agctcggcaggcagccttgctgcaggccccctgctgctcgcgctggccctcttccccctg
agcgtcctgttctga

DBGET integrated database retrieval system