KEGG   Pan paniscus (bonobo): 100987572Help
Entry
100987572         CDS       T02283                                 

Gene name
BCMO1
Definition
beta-carotene 15,15'-monooxygenase 1
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
pps  Pan paniscus (bonobo)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pps00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 547 aa AA seqDB search
MDIIFGRNRKEQQEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTKNYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGSNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFAAGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggatataatatttggcaggaataggaaagaacagcaggagcctgtgagggccaaagtg
acaggcaagattccagcatggctgcagggaaccctgctccgcaacgggcctgggatgcac
acagttggggagtccagatacaaccattggttcgatggccttgccctgctccacagcttc
accatcagagacggtgaagtctattacaggagcaaatacctgagaagcgatacctacaac
gccaatattgaggcaaacaggattgtggtgtctgagtttggaacaatggcctatccggac
ccctgcaaaaacatattttccaaagctttctcctacttgtctcacaccatccccgatttc
accgacaactgcctgatcaacatcatgaagtgcggagaagacttctacgcgacctcagag
accaattacatcaggaaaatcaacccacagactctggaaaccctggagaaggttgattat
cgtaaatacgtggcggtaaatctggcaacgtcacatccccattatgatgaggctggaaat
gttctaaacatgggcacatccattgtggaaaaggggaagacaaagtatgtgatttttaag
atccctgccacagtaccagagggcaagaagcaggggaagagcccctggaagcacacagag
gtgttctgctccatcccgtcccgctccctgctctccccaagctactaccacagctttgga
gtcaccaagaactatgtcatcttccttgagcagcctttcaggttggatattctcaagatg
gcaaccgcatacatccggagaatgagctgggcctcctgcctggctttccacagggaggag
aagacttatatccacatcatcgaccaaaggaccaggcagcctgtgcagaccaagttttac
acagacgccatggtggttttccatcacgtcaacgcctacgaagaggacggctgcatcgtg
tttgacgtcattgcctacgaggacaacagcctctaccagctcttctacctggccaacctg
aaccaggacttcaaggagaactccaggctcacctcggtccccaccctcaggagatttgcc
gtacccctccacgtggacaagaatgcagaagtgggctcaaatttaatcaaagtggcatct
acaacagccacggccctgaaggaagaagatggccaagtctactgccagccggaatttctt
tatgaaggcttagagcttccacgggtcaattatgctcacaatggaaagcaataccgatat
gtctttgctgcaggagttcagtggagtccaatcccaaccaagataataaaatatgacatt
ctcacaaagtcatccttaaaatggagagaggacgactgctggccagcggaacccctgttt
gtgcccgcgccaggtgccaaggatgaggatgatggagtaatcttatcagccattgtctct
actgatccccaaaagctgccttttctgctcattctggatgccaaaagctttacggaattg
gcccgtgcctctgttgatgtcgatatgcacatggatctccatggattattcattacagac
atggactgggacacaaaaaagcaggccgcttctgaggaacagcgggacagggcttccgac
tgccacggggctcctctgacctga

DBGET integrated database retrieval system