KEGG   Pan paniscus (bonobo): 100987645Help
Entry
100987645         CDS       T02283                                 

Definition
thymosin beta-4-like
Orthology
K05764  
thymosin, beta 4
Organism
pps  Pan paniscus (bonobo)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100987645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system