KEGG   Pan paniscus (bonobo): 100987666Help
Entry
100987666         CDS       T02283                                 

Gene name
USP30
Definition
(RefSeq) ubiquitin specific peptidase 30
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100987666 (USP30)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100987666 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 517 aa AA seqDB search
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTL
LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLG
HKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDT
VRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggccgaggcggcgatgaccgcggccgacagggccatccagcgcttc
ctgcggaccggggcggccgtcagatataaagtcatgaagaactggggagttataggtgga
attgctgctgctcttgcagcaggaatatatgttatttggggtcccattacagaaagaaag
aagcgtagaaaagggcttgtgcctggccttgttaatttagggaacacctgcttcatgaac
tccctgctacaaggcctgtctgcctgtcctgctttcatcaggtggctggaagagttcacc
tcccagtactccagggatcagaaggagcccccctcacaccagtatttatccttaacactc
ttgcaccttctgaaagccttgtcctgccaagaagttactgatgatgaggtcttagatgca
agctgcttgttggatgtcttaagaatgtacagatggcagatctcatcatttgaagaacag
gatgctcacgaattattccatgtcattacctcgtcattggaagatgagcgagaccgccag
cctcgggtcacacatttgtttgatgtgcattccctagagcagcagtcagaaataactccc
aaacaaattacctgccgcacaagagggtcacctcaccccacatccaatcactggaagtct
caacatccttttcatggaagactcactagtaatatggtctgcaaacactgtgaacaccag
agtcctgttcgatttgatacctttgatagcctttcactaagtattccagccgccacatgg
ggtcacccattgaccctggaccactgccttcaccacttcatctcatcagaatcagtgcgg
gatgttgtgtgtgacaactgtacaaagattgaagccaagggaacgttgaacggggaaaag
gtggaacaccagaggaccacttttgttaaacagttaaaactagggaagctccctcagtgt
ctctgcatccacctacagcggctgagctggtccagccacggcacgcctctgaagcggcat
gagcacgtgcagttcaatgagttcctgatgatggacatttacaagtaccacctccttgga
cataaacctagtcaacacaaccctaaactgaacaagaacccagggcctacactggagctg
caggatgggccaggagcccccacaccagttctgaatcagccaggggcccccaaaacacag
atttttatgaatggcgcctgctccccatctttattgccaacgctgtcagcgccgatgccc
ttccctctcccagttgttcccgactacagctcctccacatacctcttccggctgatggca
gttgtcgtccaccatggagacatgcactctggacactttgtcacttaccgacggtcccca
ccttctgccaggaaccctctctcaaccagcaatcagtggctgtgggtctccgatgacact
gtccgcaaggccagcctgcaggaggtcctgtcctccagcgcctacctgctgttctacgag
cgcgtcctttccaggatgcagcaccagagccaggagtgcaagtctgaagaatga

DBGET integrated database retrieval system