KEGG   Pan paniscus (bonobo): 100987712Help
Entry
100987712         CDS       T02283                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pps03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:pps04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:pps04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:pps04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 242 aa AA seqDB search
MLAVEVSEAEGGIREWEEEEKEEEAAERTPTGEKSPNSPRTLLSLRGKAWTGGRMEVKLE
LHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFK
DGIEPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVN
IRTKGDKIAVWTREAENQAGVLHIGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKF
VV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgttgaggtgagtgaagctgagggtggaatccgagagtgggaggaggaggag
aaggaggaggaggcagcagagaggacacccacgggagaaaagtctccaaactctcccagg
actttgctgtctctgagagggaaggcctggacggggggccgcatggaagtcaagctggag
ctgcaccccttgcagaacaggtgggctctgtggttcttcaagaatgaccgcagccgggcc
tggcaggacaacctgcacctggtcaccaaggtggacactgtggaggacttctgggcgcta
tacagtcacatccagctggccagcaagctctcctctggctgtgactatgccctcttcaag
gatggcatcgagcccatgtgggaggacagcaggaataagcggggtggccgctggctggtc
agcctggccaagcagcagcgccacattgagctggaccggctgtggctggagacgctgctg
tgtctgatcggggagagctttgaggaacacagcagagaggtatgtggggccgtcgtcaac
atccgcaccaagggggacaagatcgctgtgtggacgagggaggcggaaaaccaggcgggc
gtgctgcacattgggcgtgtatacaaagagcgcctgggcctctccccaaagaccatcatt
gggtaccaggcccatgcagacacagccaccaagagcaactccctagccaagaacaagttt
gtggtgtga

DBGET integrated database retrieval system