KEGG   Pan paniscus (bonobo): 100987877Help
Entry
100987877         CDS       T02283                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100987877 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYVSPNMERGR
ERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHKPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCGVQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHASSYDAKRAQVFHVCGPEDVCEAYRHVLGQDKVSYEVP
RLHGDEERFFVEGLSFPDAGFTGLIFFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYIQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINY
NKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP
KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRRKPFSFKWW
NMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagagaatcgtgcgtgtgtccctggagcatcccaccagcgcggtgtgtgtg
gctggcgtggagaccctcgtggacatttatgggtcagtgcctgagggcacagaaatgttt
gaggtctatgggacgcctggcgtggacatctacgtctctcccaacatggagaggggccgg
gagcgtgcagacaccaggcggtggcgctttgacgcgactttggagatcatcgtggtcatg
aactcccccagcaatgacctcaacgacagccatgttcagatttcctaccactccagccat
aagcctctgcccctggcctacgcggtgctctacctcacctgtgttgacatctctctggat
tgcgacctgaactgtgagggaaggcaggacaggaactttgtagacaagcggcagtgggtc
tgggggcccagtgggtatggcggcatcttgctggtgaactgtgaccgtgatgatcccagc
tgtggtgtccaggacaactgtgaccagcacgtgcactgcctgcaagacctggaagacatg
tctgtcatggtcctgcggacgcagggccctgcagccctctttgatgaccacaaacttgtc
ctccatgcctccagctatgatgccaaacgggcacaggtcttccacgtctgcggtcctgag
gatgtgtgtgaggcctataggcatgtgctgggccaagataaggtgtcctatgaggtaccc
cgcttgcatggggatgaggagcgcttcttcgtggaaggcctgtccttccctgatgccggc
ttcacaggactcatcttcttccatgtcactctgctggacgactccaacgaggatttctcg
gcatcccctatcttcactgacactgtggtgttccgagtggcaccctggatcatgacgccc
agcactctgccgcccctagaggtgtatgtgtgccgtgtgaggaacaacacgtgttttgtg
gatgcggtggcagagctggccaggaaggccggctgcaagctgaccatctgcccacaggcc
gagaaccgcaacgaccgctggatccaggatgagatggagctgggctacattcaggcgccg
cacaagaccctcccggtggtctttgactccccaaggaatggggaactgcaggatttccct
tacaaaagaatcctgggtccagattttggttacgtgactcgggaaccacgcgacaggtct
gtgagtggcctggactcctttgggaacctggaggtcagccccccagtggtggccaatggg
aaagagtaccccctggggaggatcctcattgggggcaacctgcctgggtcaagtggccgc
agggtcacccaggtggtgcgggacttcctccatgcccagaaggtgcagccccccgtggag
ctctttgtggactggttggccgtgggccatgtggatgagtttctgagctttgtccctgcc
ccagatgggaagggcttccggatgctcctggccagccctggggcctgcttcaagctcttc
caggaaaagcagaagtgtggccacgggagggccctcctgttccagggggttgttgatgat
gagcaggtcaagaccatctccatcaaccaggtgctctccaataaagacctcatcaactac
aataagtttgtgcagagctgcatcgactggaaccgtgaggtgctgaagcgggagctgggc
ctggcagagtgtgacatcattgacatcccacagctcttcaagaccgagaggaaaaaagca
acggccttcttccctgacttggtgaacatgctggtgctggggaagcacctgggcatcccc
aagccctttgggcccatcatcaatggctgctgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctccactgcaccttcattgatgacttcactccataccacatgctg
catggggaggtgcactgtggcaccaatgtgcgcagaaagcccttctctttcaagtggtgg
aacatggtgccctga

DBGET integrated database retrieval system