KEGG   Pan paniscus (bonobo): 100988020Help
Entry
100988020         CDS       T02283                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100988020 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100988020 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100988020 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100988020 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100988020 (PLCZ1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100988020 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 608 aa AA seqDB search
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECGKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETRERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEDM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVESQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatggtttttgtcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagcaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgcctactgtttaaaaatgaatgtggaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattattg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaaccactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacgcgtgaaagaaaaggttctgataagcgtggagacaatcaa
gacaaggaaacaggggtaaaaaagttacctggagtaatgcttttcaagaaaaagaagacc
aggaagctaaaaattgctctggctttatctgatcttgtcatttatacgaaagctgagaag
ttcaaaagctttcaacattcaagattatatcagcaatttaatgaaaataattctattggg
gagacacaagcccgaaaactttcaaaattgcgagtccatgagtttatttttcacaccagg
aagttcattaccagaatatatcccaaagcaacaagagcagactcttctaattttaatccc
caagaattttggaatataggttgtcaaatggtggctttaaatttccagacccctggtctg
cctatggatctgcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacatttcttaagagagagtaaatcatactttaacccaagtaacataaaagaggatatg
ccaattacacttacaataaggctcatcagtggtatccagttgcctcttactcattcatca
tctaacaaaggtgattcattagtaattatagaagtttttggtgttccaaatgatcaaatg
aagcagcagactcgtgtaattaaaaaaaatgcttttagtccaagatggaatgaaacattc
acatttattattcatgtcccagaattggcattgatacgttttgttgttgaaagtcaaggt
ttaatagcaggaaatgaatttcttgggcaatatactttgccacttctatgcatgaacaaa
ggttatcgtcgtattcctctgttttccagaatgggtgagagccttgagcctgcttcactg
tttgtttatgtttggtacgtcagataa

DBGET integrated database retrieval system