KEGG   Pan paniscus (bonobo): 100988032Help
Entry
100988032         CDS       T02283                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C, delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100988032 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100988032 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100988032 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100988032 (PLCD4)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100988032 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 861 aa AA seqDB search
MASLLQDQLTTDQDLLLMQEGMPMHKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTVVFHGRRSNLDLVANSVEEALIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREKQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKVVTCPLFCPSICCQIVAQAPISKPESLLLSRQVRQEGEYSGEAVGRGLGWMAIIFFS
LRLLRVQFHLLFHLLQKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETK
AKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMD
ICDGHFRQNGGCGYVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKE
GSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYD
WKSRNDFIGQYTLPWTCMQQGEPAPLTPGQYPSSGCLPNAVLLPLPGYRHIHLLSKDGIS
LRPASIFVYICIQEGLEGDES
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcacaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccgttgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgaggaggccctgatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccgagagaagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagcatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagtggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacgtcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcacctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagagcctgagttggaggagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaaggttgtgacgtgcccgctgttttgtccgtctatctgttgtcagattgtggcc
caggctcctatttccaagcctgagtcccttctcttgtcccggcaggtgaggcaggaggga
gaatacagtggggaggcagtgggcagaggtttaggttggatggccattatcttcttctct
ctcagactgctgagggttcaattccatcttcttttccaccttctccagaaatccaagccc
atcttgtgtccagccctctcttccctggttatctacttgaagtctgtctcattccgcagc
ttcacacattcaaaggagcactaccacttctacgagatatcatctttctctgaaaccaag
gccaagcgcctcatcaaggaggctggcaatgagtttgtgcagcacaatacttggcagtta
agccgtgtgtatcccagcggcctgaggacagactcttccaactacaacccccaggaactc
tggaatgcaggctgccagatggtggccatgaatatgcagactgcagggcttgaaatggac
atctgtgatgggcatttccgccagaatggcggctgtggctatgtgctgaagccagacttc
ctgcgtgatatccagagttctttccaccctgagaagcccatcagccctttcaaagcccag
actctcttaatccaggtgatcagcggtcagcaactccccaaagtggacaagaccaaagag
gggtccattgtggatccactggtgaaagtgcagatctttggtgtccgtctagacacagca
cggcaggagaccaactatgtggaaaacaatggttttaatccatactgggggcagacacta
tgtttccgggtgctggtgcctgaacttgccatgctgcgttttgtggtaatggattatgac
tggaaatcccgaaatgactttattggtcagtacaccctgccttggacctgcatgcaacaa
ggtgagccagcccctttgacccctggccaataccccagctctggctgccttcctaatgct
gtcctcctgccccttccaggttaccgccacattcacctgctgtccaaagatggcatcagc
ctccgcccagcttccatctttgtgtatatctgcatccaggaaggcctggagggggatgag
tcctga

DBGET integrated database retrieval system