KEGG   Pan paniscus (bonobo): 100988032Help
Entry
100988032         CDS       T02283                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pps00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:pps04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:pps04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pps04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 794 aa AA seqDB search
MASLLQDQLTTDQDLLLMQEGMPMHKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTVVFHGRRSNLDLVANSVEEALIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREKQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKVVTCPLFCPSICCQIVAQAPISKPESLLLSRQKSKPILCPALSSLVIYLKSVSFRSF
THSKEHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELW
NAGCQMVAMNMQTAGLEMDICDGHFRQNGGCGYVLKPDFLRDIQSSFHPEKPISPFKAQT
LLIQVISGQQLPKVDKTKEGSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLC
FRVLVPELAMLRFVVMDYDWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGISLRPASIF
VYICIQEGLEGDES
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcacaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccgttgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgaggaggccctgatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccgagagaagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagcatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagtggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacgtcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcacctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagagcctgagttggaggagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaaggttgtgacgtgcccgctgttttgtccgtctatctgttgtcagattgtggcc
caggctcctatttccaagcctgagtcccttctcttgtcccggcagaaatccaagcccatc
ttgtgtccagccctctcttccctggttatctacttgaagtctgtctcattccgcagcttc
acacattcaaaggagcactaccacttctacgagatatcatctttctctgaaaccaaggcc
aagcgcctcatcaaggaggctggcaatgagtttgtgcagcacaatacttggcagttaagc
cgtgtgtatcccagcggcctgaggacagactcttccaactacaacccccaggaactctgg
aatgcaggctgccagatggtggccatgaatatgcagactgcagggcttgaaatggacatc
tgtgatgggcatttccgccagaatggcggctgtggctatgtgctgaagccagacttcctg
cgtgatatccagagttctttccaccctgagaagcccatcagccctttcaaagcccagact
ctcttaatccaggtgatcagcggtcagcaactccccaaagtggacaagaccaaagagggg
tccattgtggatccactggtgaaagtgcagatctttggtgtccgtctagacacagcacgg
caggagaccaactatgtggaaaacaatggttttaatccatactgggggcagacactatgt
ttccgggtgctggtgcctgaacttgccatgctgcgttttgtggtaatggattatgactgg
aaatcccgaaatgactttattggtcagtacaccctgccttggacctgcatgcaacaaggt
taccgccacattcacctgctgtccaaagatggcatcagcctccgcccagcttccatcttt
gtgtatatctgcatccaggaaggcctggagggggatgagtcctga

DBGET integrated database retrieval system