KEGG   Pan paniscus (bonobo): 100988185Help
Entry
100988185         CDS       T02283                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100988185 (STAMBPL1)
Peptidases [BR:pps01002]
 Metallo Peptidases
  Family M67
   100988185 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccttttactgtgaattctctgaaaaagttagctgctatgcctgaccataca
gatgtttccctaagcccagaagagcgagtccgtgccctaagcaagcttggttgtaatatc
accatcagtgaagacatcactccacgacgttactttaggtctggagtagagatggagagg
atggcgtctgtgtatttggaagaaggaaatttggaaaatgcctttgttctttataataaa
tttataaccttatttgtagaaaagcttcctaaccatcgagattaccagcaatgtgcagta
cctgaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaacgaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatataaagctgaaattctcaaaaaattggagcatcagagattgatagaggcagaa
aggaagcggattgctcagatgcgccagcagcagctagaatcggagcagtttctgtttttc
gaagatcaactcaagaagcaagagttagcccgaggtcaaatgcgaagtcagcaaacctca
gggctgtcagagcagattgatgggagcgctttgtcctgcttttccacacaccagaacaat
tccttgctgaatgtatttgcagatcaacctaataaaagtgatgcaaccaattatgctagc
cactctcctcctgtaaacagggccttaacgccagctgctactctaagtgctgttcagaat
ttagtggttgaaggactgcgatgtgtagttttgccagaagatctttgccacaaatttctg
caactggcagaatctaatacagtgagaggaatagaaacctgtggaatactctgtggaaaa
ctgacacataatgaatttactattacccatgtaattgtgccaaagcagtctgcgggacca
gactattgtgacatggagaatgtagaggaattattcaatgttcaggatcaacatgatctc
ctcactctaggatggatccatacgcatcccactcaaactgcatttttatccagcgttgat
cttcacactcactgttcctatcaactcatgttgccagaggccattgccattgtttgctca
ccaaagcataaagacactggcatcttcaggctcaccaatgctggcatgcttgaggtttct
gcttgtaaaaaaaagggctttcatccacacaccaaggagcccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataattgtgttggatctgaggtga

DBGET integrated database retrieval system