KEGG   Pan paniscus (bonobo): 100988371Help
Entry
100988371         CDS       T02283                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100988371 (ART1)
Cellular antigens [BR:pps04090]
 Proteins
  100988371 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 327 aa AA seqDB search
MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAA
LPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRG
VRGLRFRPAGPRAAVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRPAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQS
PLSAVWSLLLLLWFLVVRAFPDGPGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcctgctatgatgtctctgcttcttgtgtctgtgggcctcatggaagcactt
caggcccagagccaccccatcacacgacgagacctcttctctcaagagattcagctggac
atggccctggcctcctttgacgaccagtacgctggctgtgctgctgccatgacagctgct
ctcccggatctcaaccacacggagttccaggccaaccaggtatatgcagacagctggaca
ctggcaagcagccaatggcaggagcgccaggccaggtggccggagtggagtctcagcccc
acccgtccatccccgccacccctgggcttccgcgatgagcacggggtggccctcctggcc
tacacggccaacagccccctgcacaaggagttcaatgcagccgtgcgtgaggcaggccgc
tcccgggcccactacctccaccacttctccttcaagacactccatttcctgctgactgag
gccctgcagctcctgggcagcggccagcgtccaccccggtgccaccaggtgttccgaggt
gtgcgcggcctgcgcttccggccagcagggccccgggccgccgtgaggctggggggcttt
gcttctgcctccctgaagaatgttgcagcccagcagtttggtgaggacaccttctttggc
atctggacctgccttggggcccctatcaagggctactccttcttccctggagaggaagag
gtgctgatccccccctttgagaccttccaagtgatcaatgccagcagaccggcccagggc
cccgcccgcatctacctccgagccctgggcaagcacagcacctacaactgcgagtacatc
aaagacaagaagtgcaagtctgggccttgccatctggataattcagccatgggtcagagc
cccctctctgcagtctggtctttgctgctgctgctctggttcctcgtggtgagggccttt
ccagacggtccaggcctcctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system