KEGG   Pan paniscus (bonobo): 100988513Help
Entry
100988513         CDS       T02283                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 519 aa AA seqDB search
MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSTVAQVVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSLLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggccgggccggcgtggctgctgctggcaatctgggtggtcctgccatcatgg
ctgtcctctgcaaaggtctcctcgctcattgagagaatctctgaccccaaggacttgaaa
aaactgctcagaacccggaataatgtactggtgctttactccaaatctgaggcggcagct
gaaaatcatctcaggttactgtccacagtggcccaggtggtgaaaggacaagggaccatc
tgctgggtggactgtggtgatgcagagagtagaaaattgtgcaagaagatgaaagttgac
ctgagcccgaaggacaaaaaggtcgaattattccattaccaggatggtgcatttcatact
gaatataaccgagctgtgacatttaagtccatagtggcctttttgaaggatccaaaaggg
cccccactgtgggaggaagatcctggagccaaagatgttgtccaccttgacagtgaaaag
gacttcagacggctcctgaagaaggaagagaagccgctcctgatcatgttttatgccccc
tggtgcagcatgtgcaagaggatgatgccgcatttccagaaggctgcgactcagctgcgg
ggccacgccgtgctggccgggatgaatgtctactcctctgaatttgaaaacatcaaggag
gagtacagcgtgcgcggcttccccaccatctgctattttgagaaaggacggttcttgttc
cagtatgacaactatgggtccacagctgaggacattgtggagtggctgaagaatccgcag
ccgccacagccccaggtccctgagactccctgggcagatgagggcggctccgtttatcac
ctgaccgatgaagactttgaccagtttgtgaaggaacactcctctgtcctcgtcatgttc
cacgccccatggtgtggccactgtaagaaaatgaagccggagtttgagaaggcagcagaa
gccctccatggagaagcggatagctctggtgtccttgcagctgtcgatgccactgtcaac
aaggccctggcagaaagattccacatctcagagtttcctacgttgaagtattttaagaat
ggagagaaatacgcagtgcccgtgctcaggacaaagaagaagtttctcgagtggatgcaa
aaccctgaggcccccccacccccagagcccacgtgggaagagcagcagacaagcttgttg
cacctggtgggggacaacttccgggagaccctgaagaagaagaaacacaccttggtcatg
ttctacgccccttggtgcccacactgtaagaaggtcattccgcactttactgctactgct
gatgccttcaaagatgaccgaaagattgcctgtgccgctgttgactgtgtcaaagacaag
aaccaagacctgtgccagcaggaggcggtcaagggctaccccactttccactactaccac
tatgggaagttcgcagaaaagtatgacagcgaccgcacagaattgggatttaccaattat
attcgagccctccgggagggagaccatgaaagactagggaaaaagaaggaagagttataa

DBGET integrated database retrieval system