KEGG   Pan paniscus (bonobo): 100988980Help
Entry
100988980         CDS       T02283                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100988980 (MAPK6)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100988980 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccaattaacagacgatgtgggctctcttacggaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaatgtactgcacagagatctcaaaccagctaatcttttcatt
aatacggaagacttggtgctgaagataggtgactttggtcttgcacggattatggatcct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgtcgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcactctcccatccttacatgagcatatattct
tttccaatggatgagccaatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtatcatgattgt
cagttttcagagcatgattggcctgtacataacaactttgatattgatgaagttcagctt
gatccaagagctctgtccgatgtcactgatgaagaagaagtacaagttgatccccgaaaa
tatttggatggagatcgggaaaagtatctggaggatcctgcttttgataccaattactct
actgagccttgttggcaatactcagatcatcatgaaaacaaatattgtgatctggagtgt
agccatacttgtaactacaaaacgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaaggaatggattg
gttaaagcccagatagcgctagaggaagcatcacagcaactggctggaaaagaaagggaa
aagaatcagggatttgattttgattcctttattgcaggaactattcagcttagttcccag
catgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccaagaaaaacaggaaaaaggaatggca
aatctggctcaattagaagccttgtaccagtcttcttgggacagccagtttgtgagtggt
ggggaggactgttttttcataaatcagttttgtgaggtaaggaaggatgaacaagttgag
aaggaaaacacttacactagttacttggacaagttctttagcaggaaagaagatactgaa
atgctagaaactgagccagtagaggatgggaagcttggggagagaggacatgaggaagga
tttctgaacaacagtggggagttcctctttaacaagcagctcgagtccataggcatcccg
cagtttcacagtccagttgggtcaccacttaagtcaatacaggccacattaacaccttct
gctatgaaatcttcccctcaaattcctcatcaaacatacagcagcattctgaaacatctg
aactaa

DBGET integrated database retrieval system