KEGG   Pan paniscus (bonobo): 100989128Help
Entry
100989128         CDS       T02283                                 

Gene name
TYR
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100989128 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100989128 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100989128 (TYR)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100989128 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MLLAALYCLLWSFQTSTGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRIWSWLLG
AAMVGAVLTALLAGLVSLLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctttgtactgcctgctgtggagtttccagacctccactggccatttc
cctcgagcctgtgtctcctctaagaacctgatggagaaggaatgctgtccaccgtggagc
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccgcttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatcttcgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactatgtcatccccatagggacctatggccaaatgaaa
aatggatcaacacccatgtttaacgatatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccttggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaacgcccgagggacctttacggcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgatgtagaattt
tgcctgagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttt
agaaatacactggaaggatttgctagtccacttactgggatagcggatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccagaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttataccactgtacagaaatggtgatttctttatt
tcatccaaagatctgggctatgactatagctatctacaagattcagacccagactctttt
caagactacattaagtcctatttggaacaagcaagtcggatctggtcatggctccttggg
gcggcgatggtaggggccgtcctcactgccctgctggcagggcttgtgagcttgctgtgt
cgtcacaagagaaagcagcttcctgaagaaaagcagccactcctcatggagaaagaggat
taccacagcttgtatcagagccatttataa

DBGET integrated database retrieval system