KEGG   Pan paniscus (bonobo): 100989128Help
Entry
100989128         CDS       T02283                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pps00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:pps00740]
Organismal Systems; Endocrine system; Melanogenesis [PATH:pps04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MLLAALYCLLWSFQTSTGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRIWSWLLG
AAMVGAVLTALLAGLVSLLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctttgtactgcctgctgtggagtttccagacctccactggccatttc
cctcgagcctgtgtctcctctaagaacctgatggagaaggaatgctgtccaccgtggagc
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccgcttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatcttcgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactatgtcatccccatagggacctatggccaaatgaaa
aatggatcaacacccatgtttaacgatatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccttggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaacgcccgagggacctttacggcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgatgtagaattt
tgcctgagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttt
agaaatacactggaaggatttgctagtccacttactgggatagcggatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccagaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttataccactgtacagaaatggtgatttctttatt
tcatccaaagatctgggctatgactatagctatctacaagattcagacccagactctttt
caagactacattaagtcctatttggaacaagcaagtcggatctggtcatggctccttggg
gcggcgatggtaggggccgtcctcactgccctgctggcagggcttgtgagcttgctgtgt
cgtcacaagagaaagcagcttcctgaagaaaagcagccactcctcatggagaaagaggat
taccacagcttgtatcagagccatttataa

DBGET integrated database retrieval system