KEGG   Pan paniscus (bonobo): 100989222Help
Entry
100989222         CDS       T02283                                 

Gene name
PADI2
Definition
(RefSeq) peptidyl arginine deiminase 2
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100989222 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 100989222
NCBI-ProteinID: XP_003814496
Position
1
AA seq 665 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcggccccagccggggcccaaaccttc
agcctgaagcactcggaacacgtgtgggtggaggtggtgcgtgatggggaggctgaggag
gtggccaccaatggcaagcagcgctggcttctctcgcccagcaccaccctgcgggtcacc
atgagccaggcgagcaccgaggccagcagtgacaaggtcaccgtcaactactatgacgag
gaagggagcattcccatcgaccaggcggggctcttcctcacggccattgagatctccctg
gatgtggacgcagaccgggatggtgtggtggagaagaacaacccaaagaaggcatcttgg
acctggggccctgagggccagggggccatcctgctggtgaactgtgaccgagagacaccc
tggctgcccaaggaggactgccgtgatgagaaggtctacagcaaggaagatctcaaggac
atgtcccagatgatcctgcggaccaaaggccccgaccgcctccccgccggatatgagata
gttctgtacatttccatgtcagactcagacaaagtgggcgtgttctacgtggagaaccca
ttctttggccaacgctatatccacatcctgggccggcggaagctctaccatgtggtcaag
tacacgggtggctccgcggagctgctgttcttcgtggaaggcctctgtttccccgacgag
ggcttctcaggcctggtctccatccatgtcagcctgctggagtacatggcccaggacatt
cccctgactcccatcttcacggacaccgtgatattccggattgctccgtggatcatgacc
cccaacatcctgcctcccgtgtcggtgtttgtgtgctgcatgaaggataattacctgttc
ctgaaagaggtgaagaaccttgtggagaaaaccaactgtgagctgaaggtctgcttccag
tacctaaaccgaggcgatcgctggatccaggatgaaattgagtttggctacatcgaggcc
ccccataaaggcttccccgtggtgctggactccccccgagatggaaacctaaaggacttc
cctgtgaaggagctcctgggcccagattttggctacgtgacccgggagcccctctttgag
tctgtcaccagccttgactcgtttggaaacctggaggtcagtcccccagtgaccgtgaac
ggcaagacatacccgcttggccgcatcctcatcgggagcagctttcctctgtctggtggt
cggaggatgaccaaggtggtgcgtgacttcctgaaggcccagcaggtgcaggcgcccgtg
gagctctactcagactggctgactgtgggccacgtggatgagttcatgtcctttgtcccc
atccccggcacaaagaaattcctgctactcatggccagcacctcggcctgctacaagctc
ttccgagagaagcagaaggacggccatggagaggccatcatgttcaaaggcttgggtggg
atgagcagcaagcgaatcaccatcaacaagattctgtccaacgagagccttgtgcaggag
aacctgtacttccagcgctgcctggactggaaccgtgacatcctcaagaaggagctggga
ctgacagagcaggacatcattgacctgcccgctctgttcaagatggacgaggaccaccgt
gccagagccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctgggcatc
cccaagccattcgggccacaggttgaggaggaatgctgcctggagatgcatgtgcgtggc
ctcctggagcccctgggcctcgaatgcaccttcatcgacgacatttctgcctaccacaaa
tttctgggggaagtccactgtggcaccaacgtccgcaggaagccgttcaccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system